KEGG   Neokomagataea sp. Ha5: E3E11_04025
Entry
E3E11_04025       CDS       T06092                                 

Gene name
mnmG
Definition
(GenBank) tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
neh  Neokomagataea sp. Ha5
Brite
KEGG Orthology (KO) [BR:neh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:neh03016]
    E3E11_04025 (mnmG)
   03036 Chromosome and associated proteins [BR:neh03036]
    E3E11_04025 (mnmG)
Transfer RNA biogenesis [BR:neh03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    E3E11_04025 (mnmG)
 Prokaryotic type
    E3E11_04025 (mnmG)
Chromosome and associated proteins [BR:neh03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    E3E11_04025 (mnmG)
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like AlaDh_PNT_C Pyr_redox FAD_binding_3 NAD_binding_8 Pyr_redox_3
Other DBs
NCBI-ProteinID: QDH16001
LinkDB
Position
complement(927805..929772)
AA seq 655 aa
MTHEESEENYDVIVVGGGHAGCEAAAVAARCGARTLLLTHDPRTIGAMSCNPAIGGIGKG
HLVREIDAFDGLMGRAADRAGIHFKLLNRSKGPAVQGPRAQTDRVLYRQAIQELLASTPN
LTIRQGAVADLLMKDGCIRGVQCESTDADSETTPIHAAQVVLTAGTFLRGVIHTGHEQLP
AGRIGERPATKLGERLAQLGLAMGRLKTGTPPRIARDSIDWEALPPDPGDTEPELFSSLS
QGITNPQLSCRITHTTAQTHRIIRDNLHLSAMYGGEIRGRGPRYCPSIEDKIVRFADKDS
HQIFLEPEGLPGTLGGALVYPNGISTSLPAEVQEAMIRSLPGLENARITTPGYAVEYDYV
DPRQLRPSLEVRTLPGLFLAGQVNGTTGYEEAAAQGLLAGLNAARASQDQAPVTLERHEA
YLGVMIDDLTLHGVSEPYRMFTSRAEYRLLLRADNADLRLTPRAIEAGCVSEERRLAFER
LQTQITEALTRAAEMQFTPAVLAQHGIDVSQDGRRRSLSDVLATGASREKITALAPWFAT
LPVRVQHHLATEARYGGYLRRQERDIQQLANEATLKLPDTLDYAHVGGLSREMQERLSQA
RPPDFAAAQRVRGITPAALVALLAHLRQRPPVQAESLPKHQAPKHQPIDRKGQRK
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgactcacgaagaaagtgaagaaaattatgacgtgatcgtggtcggcgggggccatgca
gggtgtgaagcggcagcagtggcggctcggtgcggcgcacgcaccctgctgctgacccat
gacccgcgcacgatcggcgccatgtcctgcaatccggccatcggcggcatcggcaaaggc
catctggtccgtgagatcgatgcctttgacgggcttatgggtcgcgccgctgatcgggca
ggcattcatttcaagctgctcaaccgctccaaggggccggcagtgcaggggccacgcgcg
cagaccgatcgcgtcctttaccgccaggccattcaggagctgctggccagtacgcccaat
ctcaccatccgccagggcgcggtcgccgatctgctcatgaaagacggatgcatccgcggt
gtgcagtgcgaaagcacggatgcagacagtgagacgaccccgatccatgcagctcaggtc
gtgctgacagccggcaccttcctgcgcggcgtcatccacacgggtcatgagcaacttccg
gccgggcgcattggcgagcgtcctgccacaaagctgggcgagcggctggcccagctgggc
ctggccatgggcaggctcaaaacaggcacgcccccccgaatcgcacgtgacagcattgat
tgggaagcccttccgcccgatcccggcgataccgagcccgaactgttcagcagtctttca
cagggcatcacaaatccccagctttcctgccgcatcacccatacaacagcgcagacgcac
cgcatcatccgcgacaatctgcacctgtcggccatgtatggcggtgagatccgcgggcgc
ggcccccgctactgtccctccatcgaggacaagatcgtgcgctttgccgacaaggacagc
caccagatctttctggagcccgaaggcttgcccggcaccctgggtggcgcgctggtctat
cccaacggcatcagcacctccctgcctgctgaggtgcaggaagcgatgatccgatcccta
cccggtcttgaaaatgcccgcatcaccactcccggctatgcggtggaatatgattacgtc
gacccccggcagctgcgcccctccctggaagtccgcacacttcccggcctgttcctggcc
ggtcaggtcaacggcacgacaggatacgaggaagcggcggcccagggcctgctggccggt
ctcaatgccgcacgcgccagccaggaccaggctcccgtgaccctggaacgccatgaagcc
tatctcggagtgatgatcgacgatctgaccctgcacggcgtcagcgagccttaccggatg
ttcacctcgcgcgcggaataccgcctgttgctgcgcgccgacaatgccgatctgcgcctt
accccccgcgccattgaagcgggatgcgtcagcgaagaacgcaggctggcctttgagcgg
ctgcaaacgcagatcaccgaggcccttacccgggctgcggaaatgcagttcacccccgct
gtgctggcacagcacggaatcgacgtctctcaggacgggcgcaggcgcagcctcagcgat
gtgctggcaaccggggcttccagggaaaaaatcacagcccttgcgccctggttcgccacc
ctgcctgtacgggtacagcatcatctggctacagaggcgcgctatggcgggtatttgcgc
aggcaggaacgtgatatccagcaactggcgaatgaggcaacgctgaaactgcccgatact
ctcgattacgcccatgtcggcgggctgagccgtgaaatgcaggaacgcctttcacaggcc
cgcccccctgatttcgctgcagcccagcgcgtgcgtggcatcacgccggccgcgctggtg
gcgcttctggcccatctccggcagcgaccgcctgttcaggcggagagcctcccgaagcat
caggccccaaagcatcagcccattgacaggaaaggccagcggaaatga

DBGET integrated database retrieval system