KEGG   Neokomagataea sp. Ha5: E3E11_04605Help
Entry
E3E11_04605       CDS       T06092                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
neh  Neokomagataea sp. Ha5
Brite
KEGG Orthology (KO) [BR:neh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E3E11_04605 (ahpF)
Enzymes [BR:neh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E3E11_04605 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored Glutaredoxin FAD_binding_2 Thioredoxin Thi4 NAD_binding_8 FAD_binding_3 DUF3798
Motif
Other DBs
NCBI-ProteinID: QDH15250
LinkDB All DBs
Position
1064034..1065623
Genome map
AA seq 529 aa AA seqDB search
MSKPLLDDQLKEQLRGYLKLLKDDVLLESTLDSSEASQEINTLLTGIADLSDKVSYSDKG
TAELKPSFQIRRVNSDVQVGFAGLPLGHEFPSLVLALLQVGGHPPKIPEPQLEQIRNLKG
DHAFQIIFSMTCNNCPDVVQAFNAISVINPDIQVMSIDGAQFPELVKKYDVRSVPQVFQN
GKLFSVGRIDLSDILAKLDKAGSAKVAQARVAELNAEKPYDTLIVGQGPAGCAAAIYTAR
KGLRTGLIGERFGGQIMDTAEIDNFISVPKTEGAILGRHLEEHVKDYPVDIINDQRVDKL
VPAVEKGGLHEVHLANGAHLKARTVIAATGARWRQLGIEGEDEYRTRGVAYCPHCDGPFF
KGQPVAVAGGGNSGVEAAIDLANLASHVTLLQYDDKLTADEVLQKKLATLPNVTIVLNAA
TQKIVGDGKKMTGLTWKDRKDGSEHTLDVNAIFVQIGLLPNSAWLEGTVDLSPAREIVTN
DRNETSVPGVFGAGDVTTEPYKQIIIAMGSGAIAALAAFDYLIRVPNAE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaccccttcttgacgaccagctcaaagagcagctgcgcggttatctgaagctc
ctcaaggatgatgtcctgctcgagtcgacgctcgattcgagtgaagcctcccaggagatc
aacacccttctgaccggaattgccgatctgtctgacaaggtcagctatagcgataagggc
actgccgagctgaagccttcctttcagatccgccgcgttaattccgacgtgcaggtcggc
tttgccggccttccgctgggccatgaattcccttcgcttgtcctggcgctgctgcaggtc
ggcggtcacccgcccaagattcccgagccccagctcgagcagatcaggaatctgaaaggc
gatcacgcgtttcagatcatcttctcgatgacctgcaacaactgcccggacgtggtgcag
gccttcaatgcgatcagcgtcatcaatcctgatattcaggtcatgtcgattgacggggcg
cagttcccagagctcgtgaaaaaatacgacgtccgttcggtgccgcaggttttccagaac
ggcaagcttttctcggtggggcgcattgacctgtcagatatcctggccaagctcgacaag
gcaggcagcgccaaggtcgcccaggcccgtgtggcggagctcaatgctgaaaagccctac
gacaccctgatcgtgggccagggcccggcaggctgtgcggctgccatctacacggcgcgc
aagggcctgcgcaccggtctgatcggtgagcgtttcggcggccagatcatggacacggcc
gagatcgacaacttcatctccgtgcccaagacggaaggcgcgatcctggggcgccacctg
gaagagcatgtcaaggattacccggtcgacatcatcaatgaccaacgcgtcgacaagctg
gtgcccgcggttgagaagggcggcctgcatgaagtgcatctcgccaatggcgcgcacctc
aaggcccgcactgtcatcgcggccaccggggcgcgctggcgccagctgggcattgagggc
gaggatgaataccgcacccgtggcgttgcctactgcccgcattgcgacggccccttcttc
aagggtcagccggttgcggtggccggtggcggcaacagcggcgtggaagcggcgatcgat
ctcgccaatctggcctcgcatgtcaccctgctgcagtatgatgacaagctgaccgccgat
gaggtgctgcagaagaagcttgccacgctgccgaacgtgaccatcgtgctgaatgcggcc
acccagaagatcgtgggcgacggcaagaaaatgaccggcctgacctggaaggaccgcaag
gacggcagcgagcacacgctggatgtgaatgcgattttcgtccagatcggcctgttgccc
aacagcgcctggcttgaaggcacggtggatctttccccggcgcgggaaatcgtgacgaat
gaccgcaacgaaacctcggtcccgggcgtgttcggtgccggcgatgtcacgaccgagccc
tacaagcagatcattatcgccatgggcagcggcgcaatcgcagccctggccgccttcgac
tacctgatccgagttcccaacgcggagtga

DBGET integrated database retrieval system