KEGG   Neokomagataea sp. Ha5: E3E11_05595
Entry
E3E11_05595       CDS       T06092                                 

Definition
(GenBank) NAD(P)/FAD-dependent oxidoreductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
neh  Neokomagataea sp. Ha5
Pathway
neh00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:neh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E3E11_05595
Enzymes [BR:neh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     E3E11_05595
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like NAD_binding_8 Thi4 FAD_binding_2 K_oxygenase FMO-like DAO NAD_binding_7 FAD_binding_3 Oxidored_nitro
Other DBs
NCBI-ProteinID: QDH15407
LinkDB
Position
complement(1296541..1297605)
AA seq 354 aa
MTHLPPDAPRPAPPSAAPRQLETDIAIIGAGPVGLFAAFECSMLRLGCVLMDVLDTTGGQ
CAALYPEKPIYDIPAHPSITGGGLIEALEAQIAPFEVPRLLGSQVVELTGEAGNFTLRNT
RGDIVRAKAVIIAAGAGAFGPNRPPLEGLEAFEATGCVQYYVRKRSEFAGKRVVVAGGGD
SALDWALSLSEVAAHVCLLHRRDRFRGAPDTLARIEERIAEGRVEKIVPYQLHALHGEAG
ALTHVEAQTLDGQSRLLAADVLLPFYGLSTDLGPIAQWGLETHRTSIPVEPATMATNVPG
IHAIGDVAQYPGKLKLILQGFSEGAVAAHAAFATARPEEALRFEHSTSRGAPGA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacccatctgccccctgatgccccacgccctgcgcctccctctgcagcaccccggcag
ctggaaactgacatcgccatcatcggggccgggccggtcggtcttttcgccgcttttgaa
tgcagcatgctgcgcctgggctgcgtgctcatggacgtgctggacacgacaggcgggcaa
tgcgcggccctttatccggaaaagccgatctatgatattccggctcacccctccatcacg
ggcggcgggctgatcgaggcgctggaagcgcagatcgcccctttcgaggtgccgcggctt
ctgggcagccaggtggtcgaactcacgggagaagcggggaatttcaccctgcgcaacacg
cgtggcgacatcgtgcgggccaaagccgtcatcatcgctgccggtgcaggcgctttcggc
cccaaccgtccgccgctggaggggctggaagctttcgaggcgacaggatgcgtgcagtat
tacgtccgcaagcgctcggagttcgccggcaagcgggttgtggtggcaggcggcggcgat
tcggccctggactgggcgctttccctttccgaagtggcagcgcatgtctgcctcctgcac
cggcgcgaccgtttccgcggcgcgccagatacgctggcacgcattgaggaacggatcgcc
gaagggcgggtggagaagatcgttccctatcagcttcatgccctgcacggagaggcggga
gcgctcacccatgtcgaggcgcagacccttgacggccagtcgcgcctgctggcagctgac
gtgcttctgcccttctacggcctgtcgacagatctgggcccgatcgcgcaatgggggctt
gagacacaccgcacctccatccccgttgagcccgcgacgatggccaccaatgtccccggc
atccacgccatcggtgacgtggcccagtatcccggcaagctgaagctgatcctgcagggc
ttttccgaaggcgctgtcgcagcccacgcggcttttgccacagcccgccccgaggaggcg
ctgcgcttcgagcattccaccagccgcggcgcccccggcgcctga

DBGET integrated database retrieval system