KEGG   Neisseria sp. 10023: BG910_07410Help
Entry
BG910_07410       CDS       T05718                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nei  Neisseria sp. 10023
Pathway
nei00473  D-Alanine metabolism
nei00550  Peptidoglycan biosynthesis
nei01100  Metabolic pathways
nei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BG910_07410
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BG910_07410
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BG910_07410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nei01011]
    BG910_07410
Enzymes [BR:nei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BG910_07410
Peptidoglycan biosynthesis and degradation proteins [BR:nei01011]
 Precursor biosynthesis
  Amino acid ligase
   BG910_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST ATPgrasp_Ter TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ASK27588
UniProt: A0A220S2J1
LinkDB All DBs
Position
1501083..1501994
Genome map
AA seq 303 aa AA seqDB search
MQNFGKVAVLMGGFSSEREISLDSGAAIVEALRSKGVDAHPFDPKETPLGELKTQGFQTA
FNILHGTYGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLR
EDSDFEAVEQSLGLPMFVKPAAEGSSVGVVKVKESGRLKAVYEELKHLQGEIIAERFIGG
GEYSCPVLGGKGLPSIRIIPATEFYDYEAKYNRDDTVYQCPSDLNDNDEALIRELAVRAA
DAVGAQGCSRVDFLKDEAGKLYILEINTLPGMTGHSLVPKSAAQTGVGFADLCVEILKTA
HVG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattttggtaaagtcgccgtattgatgggcggattttccagcgaacgcgaaatt
tcgttggacagcggcgcggcaatcgtagaagccttgcgcagcaaaggcgtcgatgcccat
ccgtttgacccgaaagaaacgccgctgggcgaattgaaaacacagggttttcagacggcc
ttcaatatcttgcacggcacctacggcgaagacggcgcggtgcaaggcgcgttggaactg
ctgggtattccctacaccggcagcggtgtggcggcttccgctatcggtatggacaaatac
cgctgcaaactgatttggcaggctttgggtctgcccgtacccgaatttgctgtgttgcgc
gaagacagcgattttgaggcggtcgagcagtcattgggtttgccgatgttcgtcaaaccc
gccgcagaaggcagcagcgtcggcgtggtcaaagttaaagaatcaggccgtctgaaagcg
gtttacgaagagttgaaacaccttcagggcgaaatcattgccgaacgctttatcggcggc
ggcgaatattcctgccccgtgttgggcggcaaagggctgccgagcatccgcatcattcca
gccaccgagttttacgattacgaggcgaaatacaaccgtgacgatacggtttaccaatgt
ccgtcggatttgaacgataatgacgaagcgctgatacgcgaactggctgtccgcgcggcg
gatgccgtcggcgcgcagggctgttcgcgcgtggattttttgaaagacgaagccggcaaa
ctctatattttggaaatcaataccctgccgggaatgacgggtcacagcctggtaccgaaa
tctgcggcgcagacgggtgtgggttttgccgatttgtgcgttgaaattttgaaaactgct
catgtgggatga

DBGET integrated database retrieval system