KEGG   Neisseria sp. KEM232: CGZ77_03180Help
Entry
CGZ77_03180       CDS       T05913                                 

Definition
(GenBank) sulfate ABC transporter ATP-binding protein
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
nek  Neisseria sp. KEM232
Pathway
nek00920  Sulfur metabolism
nek02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:nek00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CGZ77_03180
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CGZ77_03180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nek02000]
    CGZ77_03180
Enzymes [BR:nek01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     CGZ77_03180
Transporters [BR:nek02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    CGZ77_03180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 CysA_C_terminal TOBE_3 SMC_N TOBE TOBE_2 AAA_23 AAA AAA_22 AAA_16 NACHT RsgA_GTPase ABC_ATPase AAA_30 Rad17 SbcCD_C AAA_29 TniB AAA_28 AAA_18 AAA_25 AAA_5 AAA_15
Motif
Other DBs
NCBI-ProteinID: ASP16830
LinkDB All DBs
Position
636530..637600
Genome map
AA seq 356 aa AA seqDB search
MSITIENLDKHFGAFHALKNISLTAPTGKLTSLLGPSGCGKTTLLRIIAGLENADGGKIL
FDGQDVTAKHVRERKVGFVFQHYALFRHMNVFDNVAFGLTVKPRAERPSKEQIRAKVEAL
LSLVRLGHLAKAYPHQLSGGQRQRIALARALAVEPKLLLLDEPFGALDAKVRKELRTWLR
DIHHELGITSILVTHDQEEALEVSDQIVVMNHGRIEQTGSADDIYLRPANAFVTGFLGHT
EAFEGRIEKGAWHYGNYARPLDTQRRWQEQTATAYIRPHEWQINETRPMLAAALVHIRHS
GALAHLTLRLEDGRQIQADLPAAEAARLNLQPGQTLPLAPRQIYVFGQSELIDYAI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaccatcgaaaacctcgacaaacacttcggcgccttccacgccctgaaaaac
atctccctcaccgcgccgacgggcaaactcacctccctgctcggcccctccggctgcggt
aaaaccacccttctgcgcatcatcgccggactcgaaaacgccgacggcggcaaaatcctc
ttcgacggccaagacgtcaccgccaaacacgtgcgcgaacgcaaagtcggcttcgtcttc
cagcactacgccctgttccgccacatgaacgtcttcgacaacgtcgccttcggcctcacc
gtcaaaccccgcgccgaacggccgtcaaaagagcaaatccgcgccaaagtcgaagcactc
ctgagcctcgtccgcctcggccatctcgccaaagcctatccccaccaactctccggcggc
caacgccagcgcatcgcccttgcccgcgccctcgccgtcgaacccaaactcctcctgctc
gacgaacccttcggcgcgctcgatgccaaagtgcgcaaagaactgcgcacctggctgcgc
gacatccaccacgaactgggcatcaccagcatcctcgtcacccacgaccaggaagaagcc
ctcgaagtgtccgaccaaatcgtcgtcatgaaccacggccgcatcgagcagaccggcagc
gccgacgacatctacctgcgccccgccaacgccttcgtcaccggctttctcggccacacc
gaagccttcgaaggccgcatcgaaaaaggcgcgtggcactacggaaactatgcccggccg
ctcgacacacaacgccgctggcaggagcagaccgccaccgcctacatccgcccgcacgaa
tggcagataaacgaaacccgtcccatgctcgctgccgccctcgtccacatccgccacagc
ggcgccctcgcccaccttaccctgcgcctcgaagacggccgccaaatccaggccgacctc
cccgccgccgaagccgcccgcctgaacctgcaacccggccaaaccctccccctcgccccg
cgccaaatctacgtcttcggccaaagcgagttgatcgactacgccatctga

DBGET integrated database retrieval system