KEGG   Neisseria sp. KEM232: CGZ77_10790Help
Entry
CGZ77_10790       CDS       T05913                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nek  Neisseria sp. KEM232
Pathway
nek00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CGZ77_10790
Enzymes [BR:nek01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CGZ77_10790
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CGZ77_10790
    1.1.1.-  
     CGZ77_10790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 TrkA_N FAD_binding_3 2-Hacid_dh_C Pyr_redox_2 NAD_binding_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ASP18176
LinkDB All DBs
Position
2165266..2166330
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIVRDDVPTGPGSNYHLSKDMNF
IGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKAGDTALVG
GAGPIGLLLAAVLKAKGLKVIITELSKARKDKAREAGVADYILDPSEVDVVEEVKKLTNG
EGVDVAFECTSVNKVMDTLIEACKPTAKMVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHQETIKLVEEGKINLEPFITQRIKLDELVSEGFERLIHNNESAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttctacgacaaaggcgacatccgcatcgaagacatccccgaaccc
accgtcgcccccggcacggtcggcatcaatgtggcctggtgcggcatctgcggcaccgac
ctgcacgaatttatggaaggcccgatcttcattccgccctgcggccacccgcacccgatt
tccggcgaatcggcgccggtaacgatgggacacgaattttccggcgtggtgtatgccgtc
ggcgaaggcgtggacgacatcaaagtcggccagcacgttgtggtcgaaccttacatcgtg
cgcgatgacgtgccgaccggcccgggcagcaactaccatctttccaaagacatgaacttc
atcggcttgggtggttgcggcggcggcttgtccgaaaaaatcgccgtcaaacgccgctgg
gtgcatccgatttccgacaaaattccgcttgaccaagccgcattgatcgaaccgctgtcc
gtcggccaccacgcctatgtgcgaagcggcgcgaaagcgggcgacacggcactggtgggc
ggcgcgggtccgattggtctgctgctggcggcggttctgaaagccaaaggcttgaaagtc
atcatcaccgaattgagcaaagcgcgcaaagacaaagcccgcgaagccggtgtggccgac
tacattctcgacccgtcggaagtggacgtagtggaagaagtgaagaaactcaccaacggc
gaaggcgtggacgtggccttcgagtgcaccagcgtcaacaaagtgatggacacgctgatt
gaagcctgcaaacccaccgccaaaatggtgattgtgtcgatttggagccatccggccacg
attaacgtacacagcgtggtgatgaaggaattggacgtgcgcggcaccatcgcctactgc
aacgaccatcaggaaaccatcaaattggtggaagaaggcaaaatcaatctcgaacctttc
atcacccagcgcatcaaactcgacgagctggtttcggaaggcttcgagcggctgattcac
aataacgaatcggcggtgaagattatcgtcaatccgaatctgtaa

DBGET integrated database retrieval system