KEGG   Neisseria elongata: NELON_03810Help
Entry
NELON_03810       CDS       T03569                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
nel  Neisseria elongata
Pathway
nel00061  Fatty acid biosynthesis
nel01100  Metabolic pathways
nel01212  Fatty acid metabolism
Module
nel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NELON_03810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nel01004]
    NELON_03810
Enzymes [BR:nel01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NELON_03810
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     NELON_03810
Lipid biosynthesis proteins [BR:nel01004]
 Fatty acid synthase
  Component type
   NELON_03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AJE18094
UniProt: D4DQY4
LinkDB All DBs
Position
complement(731119..731646)
Genome map
AA seq 175 aa AA seqDB search
MTTPFVQQNSYTKEELLACGRGELFGAGNAQLPMPNMLMIDRILDINSTGGKYGKGEIVA
ELDINPDLWFFGCHFEGDPVMPGCLGLDAMWQLVGFYLGWTGAPGRGRALGCAEVKFSGQ
VLPKHKKITYHIHIKRVMNSKLVLGIADAEMSVDGRKIYEGNGLRVGLFTSTDDF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccattcgttcagcaaaacagctacaccaaagaagaactcttagcctgcggg
cgcggcgaacttttcggcgcgggcaacgcgcaactgccgatgcccaacatgctgatgata
gaccgcatcctcgacatcaacagcaccggcggcaaatacggcaaaggcgaaatcgtcgcc
gaattggacatcaaccccgacttgtggttcttcggctgccatttcgaaggcgaccccgtc
atgcccggctgcctgggcttggacgccatgtggcaattagtgggcttctatctgggctgg
acgggcgcgccgggacgcggccgcgcactgggctgcgccgaagtgaaattcagcggccaa
gtattgccgaagcacaaaaaaatcacctaccacatccacatcaaacgcgtgatgaacagc
aaactggtgctgggcatcgccgacgccgaaatgagcgtggacggccgcaaaatctacgaa
ggcaacggcctgcgcgtcggcctgttcacatctaccgacgacttctaa

DBGET integrated database retrieval system