KEGG   Neisseria elongata: NELON_03925Help
Entry
NELON_03925       CDS       T03569                                 

Definition
(GenBank) hypothetical protein
Organism
nel  Neisseria elongata
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 DUF485
Motif
Other DBs
NCBI-ProteinID: AJE18117
UniProt: D4DR15
LinkDB All DBs
Position
complement(755118..755462)
Genome map
AA seq 114 aa AA seqDB search
MMWKNFCKQAFCFVLFFLSMAFAQLLRDGGISPREWAAAGVMSVWLQLLNLSRKRQSKIW
VALPTAVGMVMYIAILMIFERQTLLPELPSKLATLGILSVLSVAVTVLYRANTD
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggaaaaacttttgtaaacaggccttttgtttcgtactgtttttcctaagtatg
gctttcgcccaattgctgcgcgacggcggcatttctccccgtgaatgggcggcggcaggc
gtaatgtccgtgtggctgcaactgttgaacctgtcccgaaagcggcagtccaaaatatgg
gttgcgttgccgacggcggtaggaatggttatgtatatcgcaatcctaatgatattcgaa
cgccaaactctgttgcccgaattgccttccaagctggcaacactgggcatcttgtctgtt
ttgtcggtagcagtaacagttttgtatcgtgccaatacagattga

DBGET integrated database retrieval system