KEGG   Neisseria elongata: NELON_09905Help
Entry
NELON_09905       CDS       T03569                                 

Definition
(GenBank) peptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
nel  Neisseria elongata
Pathway
nel00550  Peptidoglycan biosynthesis
nel01100  Metabolic pathways
nel01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nel00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NELON_09905
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NELON_09905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nel01003]
    NELON_09905
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nel01011]
    NELON_09905
Enzymes [BR:nel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NELON_09905
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NELON_09905
Glycosyltransferases [BR:nel01003]
 Polysaccharide
  Bacterial polysaccharide
   NELON_09905
Peptidoglycan biosynthesis and degradation proteins [BR:nel01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NELON_09905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AJE19187
UniProt: D4DTJ3
LinkDB All DBs
Position
1890908..1893316
Genome map
AA seq 802 aa AA seqDB search
MIKKFLTTLFGLLVGLILFAIGLLAIAVLITYPKLPALDAVQNYQPKMPLTIYSADGKLI
GSYGEERRAFTEIKEFPQVLKDAVIAAEDKRFYQHWGVDVFGVGRAMVGNLRSGGVRSGA
STITQQVARNFYLTNEQTFTRKFNEALLAYKIEQSLTKDQILELYFNQIYLGQRAYGFAA
ASQVYFNKPVQELNLAEASMLAGLPKFPSAANPLVNPKRAKQRQEYILNNMVELGMITPA
EKNAAFNQELHYERHVQDIDQTSLYVAEMARQELYEKYGEDAYTQGFKVYTTVDTESQRI
ATNALRKTLRGFDRGSAYRGAEGYLELGKDSDEDLEEIVGKYLSTMHAVDGLEPAVIIEA
SKNTGIVAQITTGDRVRLTPAQMGSARNAILNAKLEEAQLRPGAVIRLQRIKGGGWRIAQ
EPALQGALVALDVHTGAIKALVGGYNFHSKNFNRATQAMRQPGSSFKPFVYSAALAKGMT
AATLINDEPLSIPGAGRGGRPWTPKNSDGRYDGPITLRHALTKSKNMVSIRILMANGVDY
TQQYIQKFGFKPSDHPANLSMALGAGTSTPLQMAEAYAVFANGGYKVSAYVIDKIYDSQD
RLKAQMQPLVAGENAPQVIDPRNAYIMYKIMQDVVKYGTARGALSLGRSDIAGKTGTTND
NKDAWFVGFNPDIVTAVFIGFDKPRSMGRAGYGGTIALPVWVEYMRHALKSKESNGMKVP
TGLILRGGEYFYKERQTTDPSIRIDNTSSRPANENTDTGSPTRTNQDNGEQELKPINRVT
EETEVKPINRKPATDNDLNDLF
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatttctcaccacgctattcggtttgcttgtcggactgattctcttcgct
atcggcctattggcgattgctgtcttgattacctacccgaaattacctgccttagatgca
gttcaaaactaccaacctaaaatgccgctaaccatttactctgccgatggaaaattaatt
ggctcttatggtgaagaacgacgggcatttaccgaaatcaaagagtttcctcaagtatta
aaagatgctgtgattgctgcggaagacaaacgcttttatcagcattggggagtagatgta
tttggtgtaggtcgtgcaatggtgggaaatctacgctcaggcggagttcgttccggcgcc
agtacaattacacagcaggtcgcccgtaacttttatctgaccaacgaacaaacttttaca
cgaaaatttaacgaagctttacttgcttacaaaatagaacaatctttaactaaagatcag
attttagagctttatttcaaccaaatttatttggggcagcgtgcatatggctttgccgcc
gcatcacaggtttatttcaataaacccgtgcaagaactgaatttagcagaagcctcaatg
ttggcaggtttacctaaattcccttctgctgccaacccactagtcaacccgaaacgggct
aaacaacgccaagaatacatactcaataatatggttgagctcggtatgattactcctgct
gaaaaaaatgcggcttttaatcaagagctgcattacgaacgacatgtccaagatatcgac
caaacttcgttatatgttgcggaaatggcacgtcaggaactctacgagaaatatggagaa
gatgcctacacgcaaggctttaaagtgtatacaacggtagataccgaaagccaacgcatt
gccaccaatgcattacgcaaaactttacgcggctttgatcggggtagtgcttatcgtggt
gccgaaggatatttggaactgggcaaagacagtgatgaagatcttgaagaaatagtcggc
aaatacctatctaccatgcatgccgttgatgggctggaacctgccgttattattgaagca
tcaaaaaacaccggtattgtcgctcaaatcacaactggagaccgcgtccgcttaaccccc
gctcaaatgggaagtgcacgcaatgctatcctcaatgcaaaactcgaagaagcacaactt
cgtccgggtgcggttatccgcctgcaaaggatcaaaggcggcggatggcgtatcgcccaa
gaacctgccttacagggcgcattagttgccttggatgtacacaccggcgcgataaaagct
ttagttggcggttataacttccacagcaaaaatttcaaccgagctacccaagccatgcgt
cagccgggttcttcatttaaaccttttgtatattcggcagcactggcaaaaggcatgaca
gctgcaactttaataaatgacgaaccgctttccattcccggagcaggacgaggaggtcgg
ccttggacaccgaaaaattcagacggccgttatgatggtccgattacactgcgccatgca
ttgaccaaatccaaaaatatggtttccatccgtatcttgatggccaatggtgtggactat
acacaacaatatatccaaaaatttggcttcaaaccgtccgaccatcctgccaacctttca
atggcacttggggcaggaacaagcacccctttacaaatggctgaagcttatgctgtgttt
gcgaacggcggctacaaagtttctgcgtatgtcatcgacaaaatctatgattcgcaagac
cgcctcaaagcccaaatgcaaccgcttgtcgccggagagaacgcaccgcaggttatcgac
ccgcgcaatgcctacatcatgtataaaatcatgcaggatgtcgtcaaatacggtactgct
cgaggagcattgtctctgggccgctcggacattgccggcaaaaccggcacgaccaatgac
aacaaagacgcatggtttgtcggtttcaacccagacatcgtaaccgccgtcttcatcggc
ttcgacaaaccgcgcagtatgggtcgtgctggctatggcggcaccatcgccctgcctgtt
tgggtggaatatatgcgtcacgcattgaaaagcaaagaaagcaacggtatgaaagtaccg
accggcttgatactgcgtggaggagaatatttctacaaagaacgtcaaactaccgaccca
tcgattagaattgacaacaccagcagccgccccgccaatgaaaacaccgatacaggttca
ccaacccgaaccaatcaagacaatggcgaacaagagctgaaacccatcaacagggtaacg
gaagaaaccgaagtcaaaccaatcaaccgcaaacccgcgaccgataacgatttgaacgat
ttattctga

DBGET integrated database retrieval system