KEGG   Neisseria elongata: NELON_11710Help
Entry
NELON_11710       CDS       T03569                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
nel  Neisseria elongata
Pathway
nel00521  Streptomycin biosynthesis
nel00562  Inositol phosphate metabolism
nel01100  Metabolic pathways
nel01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NELON_11710
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NELON_11710
Enzymes [BR:nel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     NELON_11710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AJE19515
UniProt: A0A0B5CJD8
LinkDB All DBs
Position
complement(2255348..2256136)
Genome map
AA seq 262 aa AA seqDB search
MLAQLQNLVRHIADTEVMPRFLSVGGSEKPDGSILSEADLAAQAAFADGLRRIIDCPMLG
EEMSEQRQRDLWLHNYEGLWVVDPIDGTTNFVNGFPHFALSAAFIRHGRPELAVIYDPVA
RECFSASSGGGAYLNGRRLPLVRQEKKLHRALAGVEIKYLRSGKLSSRMNTLSPVVSIRS
MGSSTLDWCYLAAGRMDVYVHGGQKLWDYAAGALIFTEAGGCLATLEGDDFWSGAHTFQR
SVIAAVSPALFEPWLKWIRDNQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgttagcacaactgcaaaatctggtgcggcatatcgccgatacggaggtgatgccgcgc
tttctgagtgtgggcggcagcgaaaagcccgacggcagcattttatcggaggccgatttg
gccgcgcaggccgcctttgccgacgggttgaggcggattatcgactgccctatgctgggc
gaggaaatgagcgagcagcggcagcgtgatttgtggctgcataattacgaaggattgtgg
gtggttgatcccatcgacggcaccaccaattttgtaaacggctttccgcattttgcgtta
tccgcggcctttatacggcacggtcggccggagctggccgtgatttacgatcccgtagcc
cgcgaatgtttttccgcgtcgtccggcggcggcgcgtatctgaatggtcgcaggctgccg
ctggttcggcaggaaaaaaaattgcaccgcgccctggccggtgtggaaatcaaatatctg
cgttcgggcaaactttccagccgcatgaacacgctgtctcccgttgtcagcatacgcagc
atgggcagcagcactttagactggtgctatcttgccgctggtcggatggatgtatatgtt
cacggcgggcagaagttatgggattatgccgccggcgcgttgatttttaccgaagcgggc
ggttgtctggccactttggaaggcgacgatttttggagtggggcgcatactttccagcgt
tcggttattgccgcggtcagtcccgctttgtttgagccgtggctgaagtggatacgcgac
aaccaataa

DBGET integrated database retrieval system