KEGG   Neorhizobium sp. NCHU2750: NCHU2750_13560Help
Entry
NCHU2750_13560    CDS       T05650                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
nen  Neorhizobium sp. NCHU2750
Brite
KEGG Orthology (KO) [BR:nen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nen03012]
    NCHU2750_13560 (tuf)
   03029 Mitochondrial biogenesis [BR:nen03029]
    NCHU2750_13560 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nen04147]
    NCHU2750_13560 (tuf)
Translation factors [BR:nen03012]
 Eukaryotic Type
  Elongation factors
   NCHU2750_13560 (tuf)
 Prokaryotic Type
   NCHU2750_13560 (tuf)
Mitochondrial biogenesis [BR:nen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NCHU2750_13560 (tuf)
Exosome [BR:nen04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NCHU2750_13560 (tuf)
  Exosomal proteins of breast cancer cells
   NCHU2750_13560 (tuf)
  Exosomal proteins of colorectal cancer cells
   NCHU2750_13560 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AYD00747
UniProt: A0A386DVT7
LinkDB All DBs
Position
1405380..1406555
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVIKGSALAALEDSDKK
IGEDAIRELMEAVDSYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRATSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVDRNGVERGQILCKPGSVKPHK
KFNAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVVVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcgcaataagcctcacgtcaacatcggcacgatcggtcac
gtcgaccacggcaagacctcgctgacggctgcgatcacgaagtacttcggtgaattcaag
gcgtatgaccagatcgacgctgctccggaagaaaaggcacgcggcatcaccatctcgacg
gcccacgtcgaatatgagacgccgaaccgccactatgcgcacgttgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtt
tgctcggcagctgacggcccgatgccgcagacccgcgagcacatcctgcttgctcgccag
gttggcgttccggcaatcgtcgtgttcctcaacaaggtcgaccaggtcgacgacgcagaa
cttctcgagctcgtcgagcttgaagttcgcgaactcctgtcctcctacgacttcccgggc
gacgacattccggtcatcaagggctctgctcttgctgctctggaagattccgacaagaag
atcggcgaagacgcgatccgcgaactgatggaagctgtcgattcttacatcccgacgcct
gagcgtccggttgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggc
cgtggtacggttgtgaccggtcgcgtcgagcgcggcattgtcaaggttggtgaagaagtc
gaaatcgtcggcatccgcgccacctcgaagacgacggttaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggtgcactggttcgcggcgttgac
cgtaacggcgtcgagcgtggccagatcctgtgcaagccgggctctgtcaagccgcacaag
aagttcaatgccgaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgacgggtatcgtcacg
cttccggaaggcacggaaatggttatgccgggcgacaacgtcacggttgttgttgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgccggcatcgtcgcctcgatcatcgagtaa

DBGET integrated database retrieval system