KEGG   Neorhizobium sp. NCHU2750: NCHU2750_15980Help
Entry
NCHU2750_15980    CDS       T05650                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00061  Fatty acid biosynthesis
nen00780  Biotin metabolism
nen01100  Metabolic pathways
nen01212  Fatty acid metabolism
Module
nen_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCHU2750_15980 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCHU2750_15980 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nen01004]
    NCHU2750_15980 (fabZ)
Enzymes [BR:nen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     NCHU2750_15980 (fabZ)
Lipid biosynthesis proteins [BR:nen01004]
 Fatty acid synthase
  Component type
   NCHU2750_15980 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AYD00988
UniProt: A0A386DWG2
LinkDB All DBs
Position
1638446..1638919
Genome map
AA seq 157 aa AA seqDB search
MLLEYFQMIDRVETLDLEGKTLTARSTVPAKSPVFEGHFPGMPLVPGVLLIETMAQASGM
LVLAATDFAAMPFLMSVDGAKMRAFVEPEAVLDIEAFLEHEGSGYAVTKAKISSGGKKVC
DAQLKLRTMPFSDIPLGPIVRKRAEEVGLVAAMKAGG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttgaatatttccagatgatcgatcgggtggaaacgctcgatcttgaaggaaag
acgctgacggcccgttcgacggtgccggcgaagagccccgtattcgaggggcattttccc
ggcatgccgctcgttccgggcgtgcttctcatcgaaaccatggcgcaggcctccggcatg
ctggtgcttgctgccacggattttgccgccatgcccttcctgatgtccgtcgatggcgcc
aagatgcgcgctttcgtcgagcccgaagccgtactcgacatagaggcgtttctcgagcac
gagggttcgggttatgccgtcaccaaggcgaagatctcgtcgggtggcaagaaggtctgt
gatgcccagctgaagctgcgcaccatgccgttttccgacatcccgctcggcccgatcgtc
cgcaagcgcgcggaggaagtggggctggtcgcggcgatgaaggccggtggttga

DBGET integrated database retrieval system