KEGG   Neorhizobium sp. NCHU2750: NCHU2750_21270Help
Entry
NCHU2750_21270    CDS       T05650                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00473  D-Alanine metabolism
nen00550  Peptidoglycan biosynthesis
nen01100  Metabolic pathways
nen01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NCHU2750_21270 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCHU2750_21270 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NCHU2750_21270 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nen01011]
    NCHU2750_21270 (ddl)
Enzymes [BR:nen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NCHU2750_21270 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:nen01011]
 Precursor biosynthesis
  Amino acid ligase
   NCHU2750_21270 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N GARS_A ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AYD01512
UniProt: A0A386DY66
LinkDB All DBs
Position
complement(2199829..2200755)
Genome map
AA seq 308 aa AA seqDB search
MSGKHVAVLMGGFSSERPVSLSSGNACADALEGEGYRVARVDVGRDVAAVLSELRPDVAF
NALHGPFGEDGTIQGVLEYLQIPYTHSGVLASALAMDKGQAKHVAKAAGIPVADALVMDR
KDFTTSHPMPAPYVVKPVREGSSFGVVIVREDQSHPPQIVTSSEWRYGDAVMVERYVYGR
ELTCGVMDGKALGVTEVVTEGPGFYDYDAKYAAGGSRHVIPAQISPNIYQKIQALSVMAH
EAIGCRGVSRSDFRFDDRFSDEGEVIWLEVNTQPGMTPTSLVPEMAAHEGYSFGELVRWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaagcacgtggctgttttgatgggaggattttcctccgagcggcctgtcagc
ctgtcctccggcaatgcgtgcgcagatgctctggaaggtgaaggctatcgtgttgcccgc
gtcgacgtcgggcgcgacgtcgcggccgtcctgtccgagttgcgtcccgatgttgcattc
aatgctctgcatggtcccttcggtgaagacggcacgatccagggtgttctggaatatctg
cagataccctacacgcattcgggtgtgcttgcttcggctcttgctatggacaaggggcag
gccaagcatgtcgccaaggcagccggcattccggttgccgatgcgctcgtcatggaccgc
aaggatttcaccacctctcatccgatgcctgctccctatgtggtgaagccggttcgcgaa
gggtcgtccttcggtgtcgtcatcgttcgcgaggatcaatctcatccgccgcagatcgtc
acgtcgtccgagtggcgttatggcgatgccgtcatggtcgagcgttacgtctatggtcgc
gaactgacctgcggcgtgatggacggcaaggcgctcggggtgacggaagtcgtcacggaa
gggccgggattttacgattacgatgcgaaatatgccgccggcggctctcgtcatgtcatt
ccggcacaaatttcaccgaatatttaccaaaaaatacaagcattgtcggtcatggcgcat
gaggcgattggttgccgcggtgtgagtcgctcggacttccgcttcgatgatcgtttttcc
gatgaaggcgaagtcatctggcttgaggtcaacacccagcccggcatgacgccgacgtct
ctggtgccggaaatggctgctcatgagggatattccttcggagagcttgttcgctggatg
gtggaggacgcttcgtgtctacggtga

DBGET integrated database retrieval system