KEGG   Neorhizobium sp. NCHU2750: NCHU2750_23960Help
Entry
NCHU2750_23960    CDS       T05650                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00240  Pyrimidine metabolism
nen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NCHU2750_23960 (tdk)
Enzymes [BR:nen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     NCHU2750_23960 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AYD01781
UniProt: A0A386E019
LinkDB All DBs
Position
complement(2485704..2486285)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYATMNAGKSTMLLQASYNYRERGMRTAIFIAALDDRAGKGRVSSRIGLSSDAI
PFGSEDDLFAAITAMHGEEPLACVFVDEAQFLSAEQVWQLARISDRIGIPVMAYGLRTDF
QGKLFPGSYELLAIADELREVRTICHCGRKATMVVRVDAEGEVIREGAQVEVGGNERYVS
LCRRHWEDKMRCH
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctattttcactacgcgacgatgaatgccggcaagtcgaccatgctcttg
caggcctcctataactatcgggaacggggcatgcgcacggcgatcttcatcgccgcgctc
gacgaccgtgccggcaaggggagggtttcctcccggatcggcctgtcgtcggatgccatc
cccttcggttccgaggacgacctttttgccgcgatcaccgccatgcatggcgaggagccg
ctggcctgcgtcttcgtcgacgaagcgcagtttctctccgccgagcaggtctggcagctg
gcgcggatctcagaccggatcggcattcccgtcatggcctatggcctgagaacggatttt
cagggcaagctttttcccggttcatacgagctgctcgccattgccgacgaattgcgcgag
gtgcgcacgatctgccattgcggtcgcaaggccaccatggtcgtcagggtcgatgccgaa
ggcgaagtgatccgcgagggcgcgcaggtcgaggtcggcggcaacgagcgatatgtgtcg
ctctgccggcgccattgggaagacaagatgcgttgccactga

DBGET integrated database retrieval system