KEGG   Neorhizobium sp. NCHU2750: NCHU2750_32590Help
Entry
NCHU2750_32590    CDS       T05650                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00564  Glycerophospholipid metabolism
nen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NCHU2750_32590 (glpA)
Enzymes [BR:nen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NCHU2750_32590 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 STPPase_N Pyr_redox_2 DUF5612 FAD_binding_2 GIDA
Motif
Other DBs
NCBI-ProteinID: AYD02644
UniProt: A0A386E2I2
LinkDB All DBs
Position
complement(3384391..3385902)
Genome map
AA seq 503 aa AA seqDB search
MSGDTVFDLFVVGGGINGCGIARDAAGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLE
HYEFRLVREALMEREVLWAMAPHVIWPLRFVLPYQKGGVRPAWLIRLGLFLYDNLGGRKL
LPATKTLNLRTDPAGKPLKPVFGKAFEYSDGWVDDARMVVLNARDAANRGAAILSRAKVV
SARRENGVWQIEVRDEASGVTTAHKARMLVNAGGPWVDQVLAGAIGRNNVHNVRLVQGSH
IVVKKKFEDRRAYFFQNPDNRIFFAIPYEQDFTLIGTTDRDFPGDPKDVKISPEEIQYLC
KAASEYFAEPVTADDIVWTYSAVRPLYDDGASKAQEATRDYVLKVDDAEGAPLLNVFGGK
LTTYRRLAEHALEKIGEAIGAKGNPWTGKSHLPGGDFPVTGAAEEERRLISAYPFLTPRH
AARLIRCYGTDAKAMLGDARTVEGLGRHFGGTLYEAEVRWSIEKEWALTAEDVLWRRTKQ
GLFLTAEEAVRLEEYMAGIRRAA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgatacggttttcgatctcttcgtggttggcggcggcatcaacggatgcggc
atcgcgcgcgatgcggcgggccggggctattcggtcgcgctggccgagatgaacgatttc
gcctccggcacgtcgtcgggcgccaccaagctgatccatggcggattgcgctatctcgaa
cattacgaattccggctggtgcgcgaggcgctgatggagcgcgaggtgctgtgggcgatg
gcgccgcatgtgatctggccgctgcgtttcgtgctgccctaccagaagggcggggtgcgg
ccggcatggctgatccggctcgggctgttcctctacgacaacctcggcgggcgcaagctt
ctgccggcgacgaagaccttgaacctgaggaccgatccggccggcaagccgctcaagccc
gtcttcggcaaggcgttcgaatattccgacggctgggtggatgatgcccgcatggtggta
ctcaacgcccgcgatgcggccaaccggggggcggcgatcctcagccgggccaaggtggtt
tcggcgcggcgcgagaacggggtctggcagatcgaggtgcgcgacgaggcgtccggcgtg
acgaccgcccataaggcgcggatgctggtcaatgccggcgggccgtgggtggatcaggtg
cttgccggtgcgatcggccgcaacaatgtccataatgtccgcctcgtgcagggcagccat
atcgtggtgaagaagaagttcgaggacagaagagcctatttcttccagaatccggacaac
cgcatcttcttcgccattccctatgagcaggatttcaccctgatcggcacgaccgatcgt
gattttcccggcgacccgaaggacgttaagatcagccccgaggagatccagtatctctgc
aaggcggcgagcgaatattttgccgagccggtgacggcggacgatatcgtctggacctat
tcggcggtgcgcccgctctatgacgatggtgcatcgaaggcgcaggaagcgacacgcgat
tacgtgctgaaggtggacgatgccgaaggcgcgccgctgctcaacgtattcggcggcaag
ctcaccacctatcggcggctggcggaacatgcgctggagaagatcggcgaggcgatcggt
gccaagggtaacccatggacgggcaagagccatcttccgggtggcgattttccggtgacg
ggggccgcggaagaggagcgccggcttatttcggcctatccgttcctgacgccacgccat
gcggcgcggctgatccgctgttacggcacggatgcgaaggcaatgctcggagacgccagg
accgtggagggtctcgggcggcatttcggcggcacgctttacgaagcggaggttcgctgg
tcgatcgagaaggaatgggcgctcacggctgaggatgtgctgtggcgccgcaccaagcag
ggattgttcctgacggccgaggaggctgtgaggctggaggagtacatggcgggcattcgc
cgggccgcgtag

DBGET integrated database retrieval system