KEGG   Neorhizobium sp. NCHU2750: NCHU2750_50100Help
Entry
NCHU2750_50100    CDS       T05650                                 

Gene name
bccA
Definition
(GenBank) acetyl-CoA carboxylase
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
nen  Neorhizobium sp. NCHU2750
Pathway
nen00061  Fatty acid biosynthesis
nen00280  Valine, leucine and isoleucine degradation
nen00620  Pyruvate metabolism
nen00630  Glyoxylate and dicarboxylate metabolism
nen00640  Propanoate metabolism
nen01100  Metabolic pathways
nen01110  Biosynthesis of secondary metabolites
nen01120  Microbial metabolism in diverse environments
nen01130  Biosynthesis of antibiotics
nen01200  Carbon metabolism
nen01212  Fatty acid metabolism
Module
nen_M00082  Fatty acid biosynthesis, initiation
nen_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:nen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCHU2750_50100 (bccA)
   00630 Glyoxylate and dicarboxylate metabolism
    NCHU2750_50100 (bccA)
   00640 Propanoate metabolism
    NCHU2750_50100 (bccA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCHU2750_50100 (bccA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCHU2750_50100 (bccA)
Enzymes [BR:nen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NCHU2750_50100 (bccA)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NCHU2750_50100 (bccA)
    6.4.1.3  propionyl-CoA carboxylase
     NCHU2750_50100 (bccA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C HlyD_3 HlyD_D23 RnfC_N LAL_C2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AYD04388
UniProt: A0A386E675
LinkDB All DBs
Position
pNCHU2750b:263637..265364
Genome map
AA seq 575 aa AA seqDB search
MKKVLIANRGEIAVRIIRACRDYGLTSVAVYADPDQNAPFVQMADESYGLDGVRPSETYL
DIGKLIATAKRSGADAVHPGYGFLSERAEFAQAVIDAGLIWIGPAPSVIEALGDKVEARH
IARSVGAPLVAGSDGPVSSADEVIAFAREHGLPVAIKAAHGGGGRGLKVAWNMEEIADLY
ASAVREATAAFGRGECFLERFLDRPRHIEAQVIADTHGNVLVVGTRDCSLQRRNQKLVEE
APAPFLSDDQRRKVHDAAKAICAAAGYVGAGTVEFLLGIDGTISFLEVNTRLQVEHPVTE
ETTGIDLVIEQFRIAEGLPLRVLETPVPRGHSMEFRINAEDPGRGFLPTPGNITTFVPPA
GPGIRLDSGVTAGFAVPGVFDSLIAKLIVTGSTREEVIRRARRALDEFEIGGIATVLPFH
RAVLNAEDFVNPDGMKVHTRWIETEFAAMPDAMERPEPADDTTLVHTYLEIDGKRVSVGL
PAVLLAGLAASGGTASAAAPISPVADQGVTASVSGTVQSLKVKDGDMVTEGTLLAVLEAM
KMETQVVAPRAGKVRLRVKEGDYVTAGEALITLDD
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggtgctgattgccaaccgcggcgagattgcggtgcgcatcatccgcgcgtgc
cgcgactacggcctgacatccgtcgccgtctatgccgatcccgatcagaatgctcccttc
gtacagatggccgacgagtcctatgggctggacggcgttcgcccgtcggaaacctatctc
gacatcggcaagctgatcgccactgccaagcgctccggtgcggatgccgtgcatcccggc
tacggttttctgtctgaacgtgccgaattcgcacaggcggtcatcgatgccggtctgatc
tggatcggtcctgctccatcggtcatcgaagcgctcggcgacaaggtggaggcgcgccat
atcgcccgcagcgtcggcgcaccgctggttgccggcagcgatggcccggtttcctctgcc
gacgaagtcatcgcctttgcacgcgagcatggtcttccggtcgccatcaaggccgcccat
ggcggcggtgggcgcggtctcaaggtcgcctggaatatggaagagatcgccgatctctat
gcttcggcagttcgcgaggcgacagccgccttcggtcgcggtgaatgtttcctcgaacgc
ttcctcgaccggcctcgccatatcgaggcgcaggtgatcgcagacacgcatggcaacgtc
cttgtcgtcggaacgcgtgactgctcccttcagcgacgcaaccagaagctcgtagaagag
gcgcccgcccccttcctcagtgatgatcagcgccgcaaggtgcatgacgcggcaaaggcg
atttgcgcggcggccggctacgtcggcgccggcaccgtggaattcctgctcggcatagac
ggcacgatctccttcctggaggtcaacacccgcctgcaggtcgaacatccggtgaccgaa
gagacgaccggcatcgacctcgtcatcgagcagttccgcattgccgagggactgccgctg
cgggtgctcgaaacacctgtgccgcgaggtcattcgatggaattccgcatcaatgccgaa
gatcccggccgcggcttcctgcccacaccgggcaatatcaccacctttgtcccgcccgcc
ggtcccggcatccggctcgatagcggcgttacggcaggttttgccgtgccgggcgtcttc
gatagtctcattgccaagctgatcgtcaccggctcgacccgcgaagaggttatccgccgc
gcgcgcagggctctcgacgagttcgagatcggcggcatcgccacggttctgcctttccac
cgcgccgtgctcaacgcggaggatttcgtcaatcctgatggcatgaaagtacatacacgg
tggatcgagacggaatttgccgcgatgccggacgcaatggagcgcccggaaccggccgac
gacaccacgctcgtgcacacctatcttgaaatcgacggcaaacgcgtctcggtcggcctg
cctgccgtcctccttgcaggtctcgctgcatcgggcggcacagcatccgctgctgctccg
atctccccggttgccgatcagggcgtcaccgcatctgtttccggaacggtgcagtcactc
aaggtgaaagatggcgacatggtaaccgaaggcaccctgctcgccgtgctcgaggcgatg
aagatggaaacgcaggtcgttgcgccccgggccggcaaagtcaggctgcgggtaaaggaa
ggcgactacgtgacggccggagaggctttgatcacgctcgacgattga

DBGET integrated database retrieval system