KEGG   Neorhizobium sp. SOG26: CYG48_05185Help
Entry
CYG48_05185       CDS       T05626                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
neo  Neorhizobium sp. SOG26
Brite
Translation factors [BR:neo03012]
 Eukaryotic Type
  Elongation factors
   CYG48_05185 (tuf)
 Prokaryotic Type
   CYG48_05185 (tuf)
Mitochondrial biogenesis [BR:neo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CYG48_05185 (tuf)
Exosome [BR:neo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CYG48_05185 (tuf)
  Exosomal proteins of breast cancer cells
   CYG48_05185 (tuf)
  Exosomal proteins of colorectal cancer cells
   CYG48_05185 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AXV15146
UniProt: A0A346YL14
LinkDB All DBs
Position
1035286..1036461
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMEAVDSYIPTPERPIDQPFLMPVEDVFSISGRGTVATGRVERGIVKVGEEL
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVNRDGIERGQVLCKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVAAIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaagtttgagcgcaataagccgcacgtcaacattggcacgattggtcac
gttgaccatggcaagacgtcgctgacggcggcgatcacgaagtacttcggcgagttcaag
gcctatgaccagattgatgctgcgccggaagaaaaggcacgtggcatcaccatctcgacg
gcgcacgttgagtacgagacggccaaccgccactatgcgcacgtcgactgccccggccac
gctgactatgtgaagaacatgatcacgggtgccgcacagatggacggcgcgatcctggtt
tgctcggctgctgacggcccgatgccgcagacccgcgagcacatcctgcttgctcgccag
gttggcgttccggcgatcgtcgtgttcctgaacaaggttgaccaggttgacgacgccgag
cttctcgagctcgtcgagctggaagttcgcgaacttctgtcgtcctacgacttcccgggc
gacgacattccgatcatcaagggttcggcccttgctgctcttgaagattccgacaagaag
atcggcgaagacgcgatccgcgaactgatggaagctgttgacagctacatcccgacgcct
gagcgtccgatcgaccagccgttcctgatgccggttgaagacgtgttctcgatctccggc
cgcggcacggttgccacgggccgcgttgagcgtggtatcgtcaaggttggcgaagaactg
gaaatcgttggcattcgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggcgcgcttctgcgtggtgtgaac
cgcgacggcatcgagcgtggtcaggttctgtgcaagccgggttcggtcaagccgcacaag
aagttcaaggcagaagcctacatcctgacgaaggaagaaggcggccgtcatacgccgttc
ttcacgaactaccgtccgcagttctacttccgcacgacggacgtgacgggtatcgtgacg
cttccggaaggcacggaaatggttatgcctggcgacaacgtcaccgttgacgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgtacc
gtcggcgccggtatcgtcgctgccatcgttgaataa

DBGET integrated database retrieval system