KEGG   Neorhizobium sp. SOG26: CYG48_06625Help
Entry
CYG48_06625       CDS       T05626                                 

Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00061  Fatty acid biosynthesis
neo00780  Biotin metabolism
neo01100  Metabolic pathways
neo01212  Fatty acid metabolism
Module
neo_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CYG48_06625
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CYG48_06625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:neo01004]
    CYG48_06625
Enzymes [BR:neo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CYG48_06625
Lipid biosynthesis proteins [BR:neo01004]
 Fatty acid synthase
  Component type
   CYG48_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AXV15398
UniProt: A0A346YLQ1
LinkDB All DBs
Position
1300433..1300906
Genome map
AA seq 157 aa AA seqDB search
MLLEYFQMIDRIEAVDLGAKTLKARSVVPSKSPVFEGHFPGMPLVPGVLLIETMAQASGM
LVLAASDFAAMPFLMSVDNAKMRTFVEPDAVLDIEAFLEHEGSGYAVTKAKITSNGKKVC
DAQLKLRTMPFSEIPLAPVVRKRAEEVGLMDAIAANA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcgaatatttccagatgatcgatcgcatcgaagcggtcgatctgggagcaaag
accttgaaggcgcgttcggtcgtgccttcgaagagcccggtgtttgaaggccattttccc
ggcatgcctttggtacccggtgtgcttctgatcgaaaccatggcgcaggcatccggtatg
ctggtgctggctgcttccgattttgccgccatgccgtttcttatgtcggtcgacaacgcc
aagatgcgcacattcgtggagccggacgccgtactcgatatcgaggccttcctggagcat
gaaggttcgggttacgccgtgaccaaggccaagatcacgagcaacgggaaaaaggtctgc
gacgcgcagttgaagcttcgcaccatgcctttcagtgaaatcccgctggctccggtcgtg
cgcaagcgcgccgaagaagtcggcctgatggacgccattgccgcgaacgcctag

DBGET integrated database retrieval system