KEGG   Neorhizobium sp. SOG26: CYG48_08390Help
Entry
CYG48_08390       CDS       T05626                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00473  D-Alanine metabolism
neo00550  Peptidoglycan biosynthesis
neo01100  Metabolic pathways
neo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CYG48_08390
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CYG48_08390
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CYG48_08390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:neo01011]
    CYG48_08390
Enzymes [BR:neo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CYG48_08390
Peptidoglycan biosynthesis and degradation proteins [BR:neo01011]
 Precursor biosynthesis
  Amino acid ligase
   CYG48_08390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 GARS_A ATP-grasp_3 ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AXV15712
UniProt: A0A346YML5
LinkDB All DBs
Position
complement(1681800..1682726)
Genome map
AA seq 308 aa AA seqDB search
MTDKHVAVLMGGFSSERPVSLSSGNACADALEGEGYRVTRVDVDRNVAAVLSELKPDVAF
NALHGPYGEDGTIQGILEYLEIPYTHSGVLASALAMDKHQARHVAKAAGIPVAEAKAMNR
FDIGNVHPLKPPYVVKPVREGSSFGVVIVQENQSHPPQVIGSSDWRYGDRVLVERYIYGR
ELTCGVMGDVALGVTEVVPTGNAFYDYDAKYAAGGSKHVIPAQISPNIYQKIQTLALKAH
QAMGCRGVSRSDFRYDDRFSENGELIWLEINTQPGMTPTSLVPEMAAHAGHSFGELVRWM
VEDATCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcacgtcgctgttttgatggggggattttcctccgagcggcctgtcagt
ctgtcgtcgggcaatgcttgcgcggacgctctcgaaggtgagggttaccgggtcacacgt
gtcgacgttgatcgcaatgtcgcggctgttctttctgagttgaagcccgacgtggctttc
aatgcgctccatggtccctatggcgaagacggcaccatccagggcattctggaatatctc
gagatcccttacacgcattccggtgtgctcgcctcggcgcttgccatggataagcatcag
gctcggcatgtggccaaggctgccggtattccggttgctgaagccaaggcgatgaaccgc
ttcgatattggcaacgtgcatccgctgaagccgccttacgtggtgaagccggtgcgcgaa
ggttcgtccttcggcgtcgtcatcgtccaggagaatcaatctcatccgccgcaggtcatc
ggttcgtcagattggcgttatggtgatcgcgttctcgttgagcgttacatctatggccgc
gagctgacttgtggtgtcatgggcgacgtggcgctcggtgtgaccgaggtcgtgccgacc
ggcaacgccttctacgactacgatgctaaatatgcagccggtggctccaagcacgtcatt
ccggcgcagatttcaccgaatatttaccaaaagatacaaacactggccctcaaggcgcat
caggcgatgggctgccgtggcgtcagtcgttcggacttccgctatgacgaccgcttctcc
gagaatggcgagctgatctggctcgaaatcaacactcagccaggcatgacgccaacgtcg
cttgtgcccgaaatggccgcacacgcaggtcattcctttggtgagctcgtccgttggatg
gtggaggacgctacgtgtttgcgttga

DBGET integrated database retrieval system