KEGG   Neorhizobium sp. SOG26: CYG48_09555Help
Entry
CYG48_09555       CDS       T05626                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00240  Pyrimidine metabolism
neo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CYG48_09555
Enzymes [BR:neo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CYG48_09555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22 AAA_14
Motif
Other DBs
NCBI-ProteinID: AXV15924
UniProt: A0A346YN77
LinkDB All DBs
Position
complement(1933166..1933753)
Genome map
AA seq 195 aa AA seqDB search
MAKLYFHYATMNAGKSTMLLQASYNYQERGMRTAIFTAALDDRAGQGKVASRIGLSSDAI
PFSSSDDLFETIKEMHMREPLACVFVDEAQFLTSEQVWQLARVSDHVGIPVMAYGLRTDF
QGKLFPGSLELLAIADELREVRTICFCGRKATMVVRLDAEGNLVREGAQVEVGGNEKYVS
LCRRHWEEKMRCEGA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttccactacgccacgatgaatgctggcaagtccaccatgctgctg
caagcctcctataactaccaggaaaggggcatgcgcacggcaatcttcacggccgcgctg
gatgatcgcgcagggcagggcaaggtggcctcgcgaatcggcctgtcttccgacgccatc
cccttcagtagctccgacgacctgttcgagacgatcaaggagatgcacatgcgcgagccg
ctcgcctgtgtcttcgtagatgaggcgcagttcctgacatcggagcaggtctggcagctg
gcgcgcgtgtccgaccatgtcggcattccggtgatggcctatgggttgcggaccgacttc
cagggcaagctgtttcccggatcgctggagctgctggcgattgccgacgagttgcgcgag
gtgcgcaccatctgcttttgcggccgcaaggcaaccatggtcgtgcggctcgatgccgaa
ggcaacctcgttcgcgagggcgcgcaggtggaggttggcgggaacgaaaaatacgtttcg
ctctgccgccggcactgggaagaaaagatgcgctgcgagggcgcctag

DBGET integrated database retrieval system