KEGG   Neorhizobium sp. SOG26: CYG48_10185Help
Entry
CYG48_10185       CDS       T05626                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00500  Starch and sucrose metabolism
neo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CYG48_10185
Enzymes [BR:neo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CYG48_10185
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CYG48_10185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: AXV16027
UniProt: A0A346YNI0
LinkDB All DBs
Position
2049905..2051566
Genome map
AA seq 553 aa AA seqDB search
MINDLWYKNAVIYCLSVETFMDANGDGVGDFQGLQRRLDYLAGLGVTAIWLMPFQVSPQK
DDGYDVSDYYNVDPRYGTLGDFVEFTHGAKQRGIRVLIDLVVNHTSDQHPWFQQARSDPN
SFYRDWYVWSDKKPANADEGMVFPGVQKTTWTYDEKAKQYYFHRFFKFQPDLNTANPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIDEKGAEVTKSKPQYDMLRTFREFLQWRQGDSVI
LAEANVVPKETLKYFGDDGDRMQMMFNFHVNQAMFYALAAADAEPLAKAINETRDRPATG
QWGLFLRNHDELDLGRLTEKQRQKVFQEFGPDKDMQLYDRGIRRRLAPMLQNDRRRLELA
YSLMFSLPGTPVIRYGDEIGMGDDLSLPERNCARTPMQWSDEPHGGFTKSNKPVLPVISG
GPFGFEHLNVAHQRRETNSLLNWTERLIRMRKEAPEIGVGVCTPVETSDKGVLALRYDWR
GNSVLLIHNLKSVPIEVTFDVGLEEHGNKLIDIADHANTEAGENGKHKLLLDAYGYRWFR
VGGLDYLLRRTEV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacgacctctggtacaagaacgccgtcatttattgcctgtccgtcgagaccttc
atggatgccaatggcgacggtgtcggggacttccaggggctacaacgacgtctcgattac
ctcgcgggtctcggcgtcacggcgatctggctgatgcccttccaggtctccccgcagaag
gacgacggctatgacgtgtccgactactacaatgtcgatccgcgctacggcacgctgggc
gacttcgtggagttcacccatggcgccaagcagcgcggcatccgcgtgctgatcgacctc
gtcgtcaaccacacctccgaccagcacccctggttccagcaggcgcgcagcgacccgaac
tcgttctaccgcgactggtatgtctggtcggacaagaagccggccaatgccgacgaaggc
atggtctttcccggggtgcagaaaaccacctggacctatgacgagaaggccaagcagtat
tacttccaccgctttttcaagttccagccggacctcaacaccgccaacccgcatgttcag
gcggagatcctgaagatcatgggcttctggatccagctcggcgtgtccggcttccggatg
gatgccgttcccttcgtgatcgacgagaaaggcgccgaggtcaccaaatccaagccgcaa
tacgacatgctgcggaccttccgcgagttcctgcagtggcgccagggtgactccgtcatt
ctcgcggaagccaatgtggtgccgaaggagacgctgaaatatttcggcgatgatggcgac
cgcatgcagatgatgttcaacttccacgtcaaccaggcgatgttctacgcactggcggca
gccgatgccgagccacttgccaaggccatcaacgagacgcgcgaccggccggcaaccggc
cagtggggcctattcctgcgcaaccacgacgagctcgaccttgggcgcctgacggaaaag
cagcgccagaaggtgtttcaggagttcgggccggacaaggacatgcagctttacgaccgc
ggcatccgccggcgcctggcgccgatgctgcagaatgaccggcggcggctggaactcgcc
tacagcctgatgttctcactgccgggaaccccggtgatccgttatggcgacgagatcggc
atgggtgacgacctgtcgctacccgagcgcaactgcgcccgcacaccgatgcaatggtcg
gacgaaccgcatggcggtttcaccaagagcaacaagccggtgctgccggtgatcagcggc
ggcccattcggttttgagcacctgaacgtggcgcatcagcgccgggaaacgaattcgctc
ctcaactggacggagcggctgatccgcatgcgtaaggaagcgcccgagattggcgtcggc
gtctgcacgccggtcgagacgagcgacaagggcgtgctggcgctgcggtatgactggcgc
ggcaactctgtgctgctgatccataacctcaagtcggtgccgatcgaagtgaccttcgac
gtcgggctggaggagcacgggaacaaactgatcgacatcgccgaccacgccaacaccgag
gccggcgagaacggcaagcacaagctcctgctcgacgcatatgggtatcgctggttccgc
gtcggcgggctcgactaccttctgcggcgaacggaggtttaa

DBGET integrated database retrieval system