KEGG   Neorhizobium sp. SOG26: CYG48_21305Help
Entry
CYG48_21305       CDS       T05626                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
neo  Neorhizobium sp. SOG26
Pathway
neo00564  Glycerophospholipid metabolism
neo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:neo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CYG48_21305
Enzymes [BR:neo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CYG48_21305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: AXV18280
UniProt: A0A346YUY3
LinkDB All DBs
Position
unnamed2:988008..989525
Genome map
AA seq 505 aa AA seqDB search
MNQDVLDIFVIGGGINGCGIARDAVGRGYKVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREVLWAMAPHIIWPMRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PPTATLDMRSDPAGKPLKPLFTKAFEYSDGWVDDARMVVLNARDAADKGATILPRTKVIS
ARREGGVWIIETRNTLTGETGTYTSRMLVNAAGPWVDQVIRTAFGKNDAKHVRLVQGSHI
VIRKKFEGERAYFFQNPDNRIIFAIPYERDFTLIGTTDRDFNEDPKSIQITDEETDYLCK
AASEYFREPVRREDIVWTYSAVRPLFDDGASKAQEATRDYVLKLETEEAAPLLNVFGGKL
TTYRRLAEHALEKIGEAIGPKGKPWTAQSHLPGGDFATKGYETEVAKLKSNYGFLSDGHA
RRLVRRYGTRSAVLLGNAASIADLGQHFGGDLYEAEVRYLIENEWAMSAEDVLWRRTKDG
LRVDENGKRLLEEYMAALPAGRMAG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagacgtgctggacatctttgtcattggaggcggtatcaacgggtgcggtatc
gcacgcgacgccgtcggccgtggctacaaggtggccctggcggaaatgaacgactttgca
tcgggcacctcgtccggcgcgaccaagcttatccacggcggccttcgctacctcgaacat
tacgagttccggctggttcgcgaatcgctgatggagcgcgaagtgctgtgggccatggcg
ccgcatatcatctggccgatgcgctttgtcctgccctaccacaagggcggcatccggccc
gcctggctgatcaggctgggcctgtttctctacgaccatctcggtggccgcaaactgctt
cccccgacagcgacgctcgacatgcgcagcgaccctgcgggcaaaccgttgaagccgctc
ttcaccaaggcgtttgaatattccgacggctgggtggatgacgcgcgcatggtggtgctc
aatgcgcgtgacgccgcagacaaaggtgcgacgatcctgccgcggaccaaggtcatttca
gcccgtcgtgaaggtggcgtctggatcatcgagacccgtaacacgctgactggtgaaacg
ggcacctatacttctcggatgctggtcaatgccgctggcccttgggtggaccaggtcatc
cgcaccgcgtttggcaagaacgatgccaagcatgttcggctcgtgcagggcagccacatc
gtcatccgcaagaagttcgagggcgagcgcgcctacttcttccagaacccggacaaccgg
atcatcttcgcgatcccttatgagcgtgatttcacgttgatcggcacgaccgaccgcgat
ttcaacgaggatccgaagagcatccagattaccgacgaagagacggattatctctgcaag
gcggccagcgagtacttccgcgagccggtgcggcgcgaggacatcgtctggacctattct
gccgtacgccccctcttcgatgacggtgcctccaaggcgcaggaagcgacacgcgactac
gtgctcaagctcgagaccgaagaggccgcaccgcttctcaatgttttcggcggtaagctc
accacctaccggcgcctggccgagcatgcattggagaagatcggcgaggcgatcggtcct
aagggcaagccgtggacagcgcaaagccatcttccgggcggcgatttcgcgacgaaaggc
tacgaaaccgaagttgcgaaattgaagtcaaactacggcttcctttcggacgggcatgcc
cgtcggctggttcgccgttatggcacccgatccgctgttctgttgggcaatgctgccagt
attgcagatctcgggcagcatttcggtggtgatctctatgaggcggaggttcgctacctg
atcgaaaacgaatgggcgatgagcgccgaggacgtcctttggaggaggacgaaggacggc
ttgcgcgtggatgagaatggtaagaggctgttggaggagtacatggccgcattaccagcc
ggacgaatggctggttga

DBGET integrated database retrieval system