KEGG   Nitrosomonas eutropha: Neut_0094
Entry
Neut_0094         CDS       T00393                                 

Definition
(GenBank) hypothetical protein
Organism
net  Nitrosomonas eutropha
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ABI58382
UniProt: Q0AJT9
LinkDB
Position
complement(91822..92193)
AA seq 123 aa
MVLSIRCRAVHGGVSLLLTAVLAVPLAAHADVPAQRQDLAAVLRQLDALERFVAHSAAAT
PIVPGDRYHFDYPRLLADLARVRTGIQSHLTPSRAQPRDLTELAGDYRSERAPQHNPLPQ
AQP
NT seq 372 nt   +upstreamnt  +downstreamnt
atggtgctctcgattcggtgtcgcgccgtgcacggcggcgtgtctctcctgctcacagcg
gtcttggccgtgccgcttgcggctcacgccgatgtgccagctcagcggcaagacctggct
gcggtcttgcgccaacttgatgcgttggaacgattcgtggcacacagtgcagcggccacg
cccatcgtgccgggtgatcgttaccacttcgactatccgcgcttgctggccgacctggcc
cgtgtgcgtaccggcattcagtctcatctcaccccatcgcgcgctcaaccgcgggatctt
accgagttggcgggggattaccgtagtgagcgtgcgccccagcacaacccgttgccgcag
gcccagccatga

DBGET integrated database retrieval system