KEGG   Nitrosomonas eutropha: Neut_0458Help
Entry
Neut_0458         CDS       T00393                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
net  Nitrosomonas eutropha
Brite
KEGG Orthology (KO) [BR:net00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:net01004]
    Neut_0458
Enzymes [BR:net01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Neut_0458
Lipid biosynthesis proteins [BR:net01004]
 Acyl-CoA synthetase
  Unknown
   Neut_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2 Porin_1
Motif
Other DBs
NCBI-ProteinID: ABI58735
UniProt: Q0AIT6
LinkDB All DBs
Position
471867..473693
Genome map
AA seq 608 aa AA seqDB search
MSSIIAKLDVLPAQEGNSLSSEAGVVSATPTINLLSQRRADFTTLVESLEYAAQGETGHN
FYDAKGNLKSVLTYKNLCANAKIIARRLSGLGLARNSRVALIADTTPEFVELFFACRFAG
LVPFAMPVPVNLGSRAIYVQQLKGMLGGSGASVAIANLDFIEFLNEVVESLGSSELKWSG
TPEQLNLLPEADVALSPNTPDETAYLQFTSGSTRLPRGVVITERALMTNLRGIVCNGLDV
RPGDRCASWLPFYHDMGLVGLVLAPLAAQLSVDYLATRDFAVRPLQWLKLISRNRCTIAF
SQPFGLKLCTLRARDSDLMDLDLSCWRAAGVGAEMIRLDTLKSFSAKFSAAGFNEDAFLP
CYGLAESTLAVSFPDINQGVKSLRVDAKTLIEKKIAVRVQADGRKFNEFVNCGRPLPGHE
IRVVDDTDQEVPHLMVGSILVKGESVMNGYFNNAEETARAIRSDGWLDTGDIGFLFEGDL
YITGRRTDVIIVNGRNIRAQDVEELAEQQPEVRTREASAFGISDENGSTSVVLVVECRLA
SAVDRQALINRLQQMVYMAFGVSCLVELVPPHTLPRTSSGKLSRFAARQGFLRRTNMEQP
AATSYTVG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcgataatagccaaattggatgttctgccggcgcaagaaggtaattccctatct
tccgaagcaggtgttgtttcggcaacgcccacaattaatttgttgagccagagaagagct
gattttacaacattggtggagtcgcttgagtacgcagcacaaggagaaactggacataac
ttctatgacgcaaaaggtaatctcaagtctgtacttacatataaaaatttatgcgctaat
gcaaaaataattgcaagacggctgtctggccttgggctggcacgcaacagccgcgttgct
ctgatcgctgatactactccggagtttgttgagctgttttttgcctgccggtttgcgggc
cttgttccatttgccatgccggtgcccgttaatcttggtagccgtgcgatttatgtacag
cagttaaaagggatgcttgggggcagtggggcaagcgttgcaatagctaatcttgatttt
attgagtttctcaatgaggtagttgagagtctgggaagcagtgaactcaaatggagtggc
acacctgagcaattgaatctactacctgaagctgatgtggcgctttctccaaataccccg
gatgaaacggcttatctgcaatttacttccggcagtactcgtttgccgagaggagtagtt
attactgagcgggctttaatgactaatctgcgtggtatcgtttgcaatggtcttgatgtg
agacccggtgatcgatgcgcttcgtggctgcctttttaccatgatatgggtttggttggc
ttggtgttggctcctttggctgcccagttatccgttgattatttggcaacccgggatttc
gctgttcgtcctttgcaatggcttaaattgatcagtcgtaatcgctgtactattgccttt
agtcagccttttggtctcaagttatgcactttgcgcgcacgcgattctgatttaatggat
ctggacttaagttgctggcgtgccgctggtgttggggctgagatgatccggctcgataca
ttgaaaagtttttcagccaagttttcagcagcgggatttaatgaagatgctttcttgcct
tgttatggtctggctgaatctactttggctgtgtctttccctgatatcaatcagggggtg
aaaagtttacgtgtagatgccaagactttgatcgaaaaaaagatagcagtaagagttcag
gcagatggcaggaaatttaatgagtttgtgaattgcggacgtccgttgccaggccatgaa
atcagagttgtcgatgacactgatcaggaagtaccccatttgatggtgggtagtattcta
gttaaaggggaaagtgtgatgaatggctactttaacaacgcagaagagactgccagagcg
atcagatcagatggatggttagatactggagatattggttttctgtttgaaggtgattta
tatatcacagggagacgaacagatgtcattattgttaatggtagaaatattcgagcgcag
gatgtggaagagctggctgaacagcagccagaagtcagaacccgtgaagcttctgctttt
ggaatcagcgatgaaaatggctcgacgtcagtcgttttggttgtggaatgcaggctggct
tcagcagtagatcgacaagcactcattaacaggcttcagcagatggtatatatggcattt
ggggtaagttgtttggttgagctggtgcccccacatactttgccacggacatcttcagga
aaattatcgcgctttgcggcacgacaggggtttttgcggcgtacaaatatggaacaacct
gctgctaccagttatacagtcggctaa

DBGET integrated database retrieval system