KEGG   Nitrosomonas eutropha: Neut_0804Help
Entry
Neut_0804         CDS       T00393                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
net  Nitrosomonas eutropha
Pathway
net00630  Glyoxylate and dicarboxylate metabolism
net00710  Carbon fixation in photosynthetic organisms
net01100  Metabolic pathways
net01120  Microbial metabolism in diverse environments
net01200  Carbon metabolism
Module
net_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Neut_0804
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Neut_0804
Enzymes [BR:net01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Neut_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABI59071
UniProt: Q0AHW1
LinkDB All DBs
Position
822352..823773
Genome map
AA seq 473 aa AA seqDB search
MAIKTYQAGVKEYRQTYWQPDYVPLDTDILACFKITPQSGVDREEAAAAVAAESSCGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDARFYAFVAYPIDLFEEGSVVNVFTSLVGNVFGF
KAIRALRLEDVRFPIAYVKTCGGPPSGIQVERDKMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGSLDFTKDDENINSQPFMRWRDRFEFVQEATLKAEAETGERKGHYLNVTAPTP
EEMYKRAEFAKEIGAPIIMHDYLAGGLCANAGLANWCRNNGMLLHVHRAMHAVLDRNPHH
GIHFRVLTKILRLSGGDHLHTGTVVGKLEGDRASTLGWIDLLRESFVPEDRSRGIFFDQD
WGSMPGAFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTLGHPWGNAAGAHANRVALEAC
VQARNEGRQIEKEGREILTAAAQHSPELKIAMETWKEIKFEFDTVDKLDIAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaaacctatcaggccggtgtcaaggagtaccgacaaacttactggcaaccg
gattacgtgccgctagacactgacattctagcgtgttttaaaattaccccacagtctggc
gtcgatcgcgaggaggcggcggcggcggtagccgcagagtcgtcctgcggtacttggacc
acagtgtggaccgacctgctgaccgatctcgattactacaagggtcgcgcctatcgcatc
gaggatgttcccggtgacgatgctcgcttctatgctttcgtcgcgtaccccatcgacttg
ttcgaagagggttctgtggtcaacgtgttcacctctctggtgggcaatgtattcggtttc
aaggcgattcgcgccttgcgtctggaagacgtgcgtttcccgatcgcatacgtgaagacc
tgcggcggccctccgagcggcatccaggtggagcgtgacaagatgaacaagtatggtcgg
ccgctgctgggctgcaccatcaaacctaagctgggcctgtcggccaagaactacggtcgt
gcggtgtatgagtgtttgcgcggcagcttggacttcaccaaagacgacgagaacattaat
tctcagccgttcatgcgctggcgcgatcgtttcgagttcgtgcaggaggccactctgaag
gctgaggccgagaccggcgagcgtaagggtcactatctgaacgtcaccgcgccaacgcct
gaagaaatgtacaagcgcgcagaattcgccaaagagatcggtgcgccgatcatcatgcac
gattacctcgccggtggcctttgcgctaacgcaggtctggcgaactggtgccgtaacaac
gggatgttgctgcacgttcaccgcgccatgcacgccgtgctcgaccgcaacccgcatcac
ggtatccacttccgcgtgctaaccaagattctgcgcctgtccggcggagatcacttgcat
accggtaccgtggtgggcaagctggaaggtgatcgcgcctccactcttggttggatcgat
ctgctgcgcgaatccttcgtaccggaagaccgttcgcgcggtatcttctttgatcaggat
tggggttcgatgcccggcgctttcgccgtcgcgtccggcggtatccacgtgtggcacatg
cctgcgctggttgccattttcggtgacgattcggtgttgcagttcggcggcggcacgctc
ggtcatccttggggcaacgctgcaggtgcacacgctaaccgcgttgcgctcgaagcctgc
gtacaggcgcgtaatgaaggccgtcagatcgagaaagaaggtcgcgagatccttaccgcc
gcggctcagcattcgcccgaactgaagatcgccatggaaacgtggaaagagatcaagttc
gagtttgacacggttgacaagctcgacattgcccacaagtaa

DBGET integrated database retrieval system