KEGG   Nitrosomonas eutropha: Neut_1829Help
Entry
Neut_1829         CDS       T00393                                 

Definition
(GenBank) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
net  Nitrosomonas eutropha
Pathway
net00030  Pentose phosphate pathway
net00710  Carbon fixation in photosynthetic organisms
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
net01230  Biosynthesis of amino acids
Module
net_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
net_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:net00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Neut_1829
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Neut_1829
Enzymes [BR:net01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Neut_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC RNase_PH_C PsiB
Motif
Other DBs
NCBI-ProteinID: ABI60062
UniProt: Q0AF20
LinkDB All DBs
Position
1937439..1938164
Genome map
AA seq 241 aa AA seqDB search
MRKRSESFSMRALFQEPIIKIIMTQDEQKQAVAQAALQYVQVGEIIGIGTGSTTNLFIDE
LAKIKHKIEGAVASSEATAARLKQHGIEVLSLNSVADLPVYIDGADEITRNMHMIKGGGG
ALTREKIIAAVARKFICIADQSKLVKVLGKFPLPVEVIPMARSYVAREIALLGGQPAWRQ
DFTTDNGNVILDIHNLNIMNPVELESTLNQITGVVTNGLFARRGADVLLMGTDQGVETIT
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcgctctgaatccttctcaatgagagcactatttcaagaaccaattattaaa
atcatcatgacacaagacgaacaaaaacaggcagtggcacaagcagccctgcagtatgtg
caggtaggtgaaatcatcggtatcggaacagggtcgaccaccaatctttttattgatgaa
ctggccaaaatcaaacacaagattgaaggggccgtggcaagctccgaagcaaccgcagcc
cgtctgaagcaacatggcattgaggttttgagcctcaattctgttgctgacctcccggta
tatattgatggcgcagatgaaattacccggaacatgcacatgatcaaaggtggtggcggc
gcactgacacgtgaaaaaatcattgcagccgtcgctcggaagtttatctgtattgctgat
caaagcaagctggtcaaggtattgggaaaatttccgctcccggtggaggtgattccgatg
gcacgcagttatgtcgcccgggaaattgcattactgggcggacaaccagcctggcgtcag
gatttcaccactgacaatggcaatgtgattctcgacatacataatctaaatatcatgaat
ccggttgaactggaaagcacgctcaaccagatcacaggggtggtgaccaacggcctgttt
gccagacgaggcgctgatgtactgttgatgggtactgatcagggcgtggaaaccattacg
atctag

DBGET integrated database retrieval system