KEGG   Nitrosomonas eutropha: Neut_1899Help
Entry
Neut_1899         CDS       T00393                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
net  Nitrosomonas eutropha
Pathway
net00061  Fatty acid biosynthesis
net00620  Pyruvate metabolism
net00640  Propanoate metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
net01212  Fatty acid metabolism
Module
net_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:net00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Neut_1899
   00640 Propanoate metabolism
    Neut_1899
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Neut_1899
Enzymes [BR:net01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Neut_1899
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Neut_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A ATPgrasp_Ter ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABI60131
UniProt: Q0AEV1
LinkDB All DBs
Position
complement(2014594..2015952)
Genome map
AA seq 452 aa AA seqDB search
MFEKILIANRGEIALRVQRACRTMGIKTVAVHSEADAEAKYVKLADESVCIGPAASAQSY
LNIPAIISAAEVTDAEAIHPGYGFLSENADFAERVEKSGFFFIGPRPDTIRLMGDKVSAK
HAMLQAGVPCVPGSEGALPDSLDEVRKIIKEIGYPVIIKAAGGGGGRGMRVVYTEAALSN
AVITTRNEAQAAFGNPVVYAEKYLENPRHIEFQILADEYGNTVHLGERDCSMQRRHQKII
EEAPARGISIKLRNQIGERCVEACKRINYRGVGTFEFLYENNEFYFIEMNTRLQVEHPVT
EAVTGIDLVQAQIRVAAGEKLSVQQKDIVTRGHAIECRINAEDPYKLTPSAGRITQYHAP
GGPGIRVDSHIYHNYRVPPYYDSMIAKVIAYGDNRDLAIARMRIALTEMIIEGIKTNIPL
HLDLLADCNFVSDSVSIHYLENKLALYNKKTT
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaaaatattaatcgcaaatcgtggagaaatagcattgcgcgtccagcgagcg
tgccggactatgggtatcaagaccgtagcggttcattcggaagcggatgccgaagcaaaa
tatgtcaagctggccgatgaatcagtctgtatcggcccggcagcttctgcgcaaagttac
ttgaatatccccgctatcattagtgctgctgaagtaacggatgcggaagccattcatccg
ggttacggttttttatccgagaatgcggattttgcagagagggtggaaaagagcggtttt
ttctttatcggcccccgaccggatacaatccggttgatgggagataaggtctctgcaaaa
cacgcgatgctgcaggcaggtgttccctgtgtaccaggctcagagggtgcgttgccggat
tcacttgatgaagtaaggaaaattatcaaggagatcggttacccagtcattatcaaggca
gccggaggaggtggggggcgcgggatgcgcgtcgtgtacactgaagcggcgctctcgaat
gcggtgattacaacgcgtaatgaagcgcaggcggcatttggtaacccggtggtttacgca
gaaaaatacctggaaaatccgcgtcatattgaattccagatactggctgacgaatacggc
aataccgttcatctgggggagagggattgctccatgcagcgccgtcaccagaagattatt
gaagaggcgccggcgcgaggtatttcgatcaagttgcgcaatcaaattggtgagcgatgt
gtcgaggcttgcaagcgtattaattacagaggggtaggaactttcgagtttctttatgag
aacaatgaattttatttcattgaaatgaatacccggcttcaggttgagcatccggtgaca
gaagccgttactggtattgacctggttcaagcacagattcgtgtggcggcaggggaaaaa
ctgtcagtgcagcaaaaagatattgtgaccagaggacatgccatagaatgccgcatcaat
gcggaagatccctataagctgactccctcagccggacgtattacacagtaccatgctcca
ggcggtcccgggatccgagtcgattcccatatttaccataattatcgcgtgccaccttac
tatgattccatgatcgccaaggtaattgcctatggtgacaatcgtgatctcgctattgcg
cgtatgcgtattgcgcttaccgaaatgatcattgaaggaatcaaaaccaatattccgtta
catctggatcttttggcggactgtaactttgtatccgattctgtctctattcactatctt
gaaaacaagcttgcactgtataacaaaaaaacgacttga

DBGET integrated database retrieval system