KEGG   Nitrosomonas eutropha: Neut_2486Help
Entry
Neut_2486         CDS       T00393                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
net  Nitrosomonas eutropha
Pathway
net00020  Citrate cycle (TCA cycle)
net00190  Oxidative phosphorylation
net00650  Butanoate metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
Module
net_M00009  Citrate cycle (TCA cycle, Krebs cycle)
net_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
net_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:net00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Neut_2486
   00650 Butanoate metabolism
    Neut_2486
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Neut_2486
Enzymes [BR:net01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Neut_2486
    1.3.5.4  fumarate reductase (quinol)
     Neut_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like GIDA Lycopene_cycl NAD_binding_7 NAD_binding_8 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABI60693
UniProt: Q0AD89
LinkDB All DBs
Position
2613599..2615362
Genome map
AA seq 587 aa AA seqDB search
MKVKQRKFDVVIVGAGGAGMRAALQLSEAGFKVAVLSKVFPTRSHTVAAQGGIAAALGNI
TEDDWRWHMYDTVKGSDYLGDQDAIEFMCRHASEVVYELEHFGMPFDRLANGKIYQRPFG
GQSLHFGEEQASRSCAVADRTGHAMLHTLYQRNVSSNTQFFVEWLGLDLIRDHEGEVLGI
TALEMETGEVMILQARATLLATGGACRIFEASTNALINTGDGLGMAARAGIPLEDMEFWQ
FHPTGVYGAGMLISEAVRGEGGYLLNAEGERFMERYAPHAKDLASRDVVSRALVTEIMQG
RGCGPDGDHLLLKLDHLGAETIQSKLPGIREISLRFAHIDPIEAPIPVVPTAHYMMGGIP
TNYHGQVVAPYKTSPEEAVPGLYAVGECACVSVHGANRLGTNSLLDIVVFGRAAGNQIIE
DLTKNSHHKSLPQDVAEQTLTRLSRLETQKNGESVAATNAALRKTMQTHCGVFRFSDVLK
EGVEKINEIAERVKYTEIQDKSRVFNTARVEALELDNLIEVAVATMISAEARHESRGAHA
RDDFPERDDQKWLKHSLFFSKDKHLDYKPVRLKPLTVESFPPKARTY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttaaacaaaggaaatttgatgtggtcattgtcggcgcgggcggagcaggtatg
cgtgccgcattgcagttgtccgaggctggattcaaggttgcggttttatccaaggttttc
ccgacccggtcacataccgtggcagcacaaggggggattgctgcagcattgggcaatata
actgaagatgactggcggtggcacatgtatgataccgtcaagggttcggattatctcggc
gaccaggatgcgattgaatttatgtgtcgccacgcttccgaagttgtatatgagctggaa
catttcggaatgccatttgacagattggcgaatggtaaaatttatcaacgcccgtttggc
gggcaatccctacactttggtgaagagcaggccagccgttcctgtgcagttgctgatcgt
accggccatgccatgctgcatactctgtatcagcgtaatgtcagctccaacacccagttt
ttcgtggaatggttggggctggatttgatccgcgatcatgaaggcgaagtgctgggaatc
acggcactggaaatggaaactggtgaagtcatgatcttgcaggctcgtgcaacgctactg
gccacgggaggagcttgtcgcatttttgaggccagtaccaatgcgctcattaatacgggc
gatggcttgggaatggctgcgcgagcaggtattccactggaagacatggaattctggcag
tttcacccaacaggcgtgtatggtgcaggcatgctgatcagtgaggcagtgcgcggagaa
ggtggctatctgctgaatgctgagggtgaacgttttatggagcgttatgcaccccatgcc
aaggatctggccagccgggatgttgtatcgcgtgcgctggttacggagattatgcaaggc
agagggtgcggcccggacggtgatcacttgctgttaaagctggatcatctaggtgcagaa
accatccaatccaaacttcccggcatccgggaaatctcgctcagatttgcgcatatcgat
cctattgaggcacccattccggttgtcccgactgcgcactacatgatggggggtattccc
actaattatcatggccaggtggtcgctccctataaaaccagtccggaagaagccgtgccg
gggctttatgcggtcggcgaatgcgcctgtgtgtcagtacatggtgcaaaccggctgggt
acgaattcgctgctggatattgtcgtgtttggacgtgctgccggtaatcaaattattgaa
gatctgaccaaaaatagtcatcacaaatcattgccacaggatgtagcagaacaaacactg
acaaggctttcacgtctggaaacccagaagaatggagaaagtgttgctgcaacgaatgcg
gcactgcgtaaaaccatgcagacgcattgtggtgtcttccgcttttctgacgtattgaaa
gagggtgtggaaaaaattaacgaaatcgccgaacgggttaagtacactgaaattcaggac
aaaagcagggtgttcaataccgccagagtggaagcgcttgagttggataacttgattgaa
gtagctgtagctaccatgatttcagcggaagcacgccatgaaagtcggggagcgcatgct
cgtgatgattttcccgagcgggatgaccagaaatggctcaagcactctctgtttttcagc
aaggataaacacctggattataaaccggtacgactaaagccgctgaccgttgaatctttc
ccgcccaaagcgagaacctattga

DBGET integrated database retrieval system