KEGG   Nitrosomonas europaea: NE0985Help
Entry
NE0985            CDS       T00130                                 

Gene name
ftsI
Definition
(GenBank) Penicillin binding protein transpeptidase domain
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
neu  Nitrosomonas europaea
Pathway
neu00550  Peptidoglycan biosynthesis
neu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:neu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NE0985 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NE0985 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:neu01011]
    NE0985 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:neu03036]
    NE0985 (ftsI)
Enzymes [BR:neu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NE0985 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:neu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   NE0985 (ftsI)
Chromosome and associated proteins [BR:neu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    NE0985 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PQQ
Motif
Other DBs
NCBI-ProteinID: CAD84896
UniProt: Q82VS9
LinkDB All DBs
Position
1069379..1071121
Genome map
AA seq 580 aa AA seqDB search
MKILFNPSRKSAAVDLPEWRSRLIQGFLLISLIILVARAVYLQALNKDFLQQQGQSRHLR
VIEQNSQRGSIKDRNGEILAISAPVKSVWVDPKRVSATSEQIGQLADLLDMNKATVQERL
SSDKRFVYLKRQLPPERANKIAELNIKGLYLKHEFYRYYPSRELAAHILGFTDVDGRGQE
GVELAWQDVLTGEDGKRRVIKDRIGRVVEDVGQIRSPKSGQDVVLSIDSKIQYLAYRELA
RAVKEQHAKAGSIVALDVKTGEVLAMANYPAFNPNQRASMNNEVIRNRVLVDTFEPGSTL
KPFAIAVALETGRVKANTLMETSGGMMRIGRAVIRDVRDKGNLTVSQVIQTSSNVGAAKI
ALLLPPKTFWEMLNRSGFGTETGIGFPGEASGQLRAYNKWRPIEQATMSYGHGISVSLMQ
LVRAYTLFATDGELKPITLLKRDTPAVGQKVISRETAQSVRKMLELAVQPEGTGSGARIN
GYRVAGKTGTAHKRLEKRKGYASDRYISSFVGFAPASDPRVIMAIMIDEPSDGRYYGGTV
AAPVFSRVMEGTLRILNVPFDDSLGNLVTSPVPARLEDKG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctgttcaatccctctcgcaaatccgctgctgtggatcttccagaatggcgc
tctcgcctcatacagggatttttgctgatatccctgatcatactggttgcccgggctgtt
tatttacaagcactgaacaaggattttctgcagcagcagggacagtcacgccatctccgg
gtcattgaacaaaattcccagcgcggcagcatcaaagaccgcaatggtgaaatccttgcc
atcagcgcgcccgtcaaatccgtatgggtcgatcccaaaagagtgagcgccacatcggaa
cagatcgggcagctggccgatctgctggatatgaataaggccactgttcaggaacgtctc
agcagcgataagcgatttgtgtatctgaaacggcaactgccaccggaaagagcaaataag
atcgctgaactcaacatcaagggtttgtacctcaagcacgagttttatcgttactatcca
tcacgcgagctggctgcccatattctgggttttaccgatgtagacggacgcggacaggaa
ggtgtagaactggcatggcaggatgtgctcacgggtgaagacggcaaacggcgtgtcatc
aaggatcggatcgggcgtgtcgtggaagacgtcggacagatccgatctcccaaatccggc
caggatgtggtgctgtcgatcgacagtaagatacagtatctcgcttaccgggaactggcg
cgtgcagtaaaagagcagcacgccaaagccggcagtatcgtggccctggatgtcaaaaca
ggtgaagtgctggcaatggccaattacccggctttcaaccccaaccagcgcgcgagcatg
aataacgaagtcatccgcaatcgtgtgctggtcgatactttcgagccaggttcgacattg
aagccttttgccatcgccgtagcgctggaaacgggtcgcgtcaaggcaaacacactgatg
gaaacctccggcggaatgatgagaataggtagagccgtcattcgcgatgtgcgtgacaag
ggcaatctgactgtctcccaggtcattcagacctcgagtaacgtgggtgcagcaaaaatt
gccctgttactgccacccaaaacattctgggaaatgctcaaccgttccggtttcggcact
gaaaccggtattggctttcccggagaagcaagtggtcagctacgcgcctataataaatgg
cgcccgatcgaacaagccaccatgtcctacgggcatggtatttcagtcagtctgatgcaa
ctggtacgggcttatacattgtttgccacggatggagaactgaaacccatcacactgctg
aaacgcgatacgccggctgtcggccagaaagtcatttcacgtgaaaccgcacaatccgta
cgtaaaatgctggaacttgcggtgcaaccggaaggtaccggcagcggtgcacgcatcaac
ggttaccgtgtggcgggaaaaaccggtaccgcgcacaaacgtctggaaaaacggaaaggg
tacgccagcgatcgctatatttcttcgttcgtcggctttgcaccagcatccgatccgcgt
gtcatcatggcaatcatgatcgatgaaccctctgacgggcgttattatggtggcacggta
gcggcaccggtattcagccgggtaatggaaggtacattgcgaatactgaatgtgccattt
gatgattcacttggcaatctggtgacgtcccccgttcccgccagattggaagacaaagga
tga

DBGET integrated database retrieval system