KEGG   Nitrosomonas europaea: NE0994Help
Entry
NE0994            CDS       T00130                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
neu  Nitrosomonas europaea
Pathway
neu00473  D-Alanine metabolism
neu00550  Peptidoglycan biosynthesis
neu01100  Metabolic pathways
neu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:neu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NE0994 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NE0994 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    NE0994 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:neu01011]
    NE0994 (ddlB)
Enzymes [BR:neu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NE0994 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:neu01011]
 Precursor biosynthesis
  Amino acid ligase
   NE0994 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST ATP-grasp RimK ATP-grasp_4 TTL
Motif
Other DBs
NCBI-ProteinID: CAD84905
UniProt: Q82VS0
LinkDB All DBs
Position
1081345..1082262
Genome map
AA seq 305 aa AA seqDB search
MNTRDVGKVAVLLGGRSAEREISLRSGQAVLAALQRSRVNAHAFDPAGQPLENLLQQGFD
RVFIALHGRYGEDGSVQGALELMELPYTGSGILASALAMDKWRTKMIWQAAGINTPDYVM
LDASSRFRDVADRLGLPLIIKPAREGSTLGLNKVDNEQDFRSAYQAAAEYDSLVLAEQFI
QGIELTAAILDDMPLPLVRIDVAEGLYDYQAKYFSESTRYTCPSGLSAALTTRIQEQALY
AHRILGCTGWSRVDLILDENEQPFFLETNTSPGMTDHSLVPMAAKAAGISFDELVVQILE
LSCEH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacccgtgacgttggaaaagtagccgtattgctgggaggacgttccgctgaacgt
gaaatctcgctgagaagcggtcaagccgttctggcagcattgcagcggagcagggtgaat
gcccatgcattcgatccggccgggcaacctctggaaaaccttctgcagcaaggtttcgat
cgagtatttatcgcattgcatggccgttacggagaagacggttcggttcagggtgcactg
gaactgatggaactgccttataccggcagtggaatactcgccagtgcactggcaatggat
aagtggcgcacaaaaatgatctggcaggcagcgggtatcaatacgcctgattacgtcatg
ctcgatgccagcagccgtttccgggatgtggcagacaggctgggattgccgctgatcatc
aaacccgcccgggagggttcgaccctcggattgaacaaagtagacaatgaacaggatttt
cgatccgcttatcaggcagctgcagaatacgattcactggtactggccgaacagttcatc
cagggaatcgaactgactgccgccattctggatgatatgccccttcccctggtgcgcatt
gatgtggcagaaggattgtatgactaccaggccaagtatttttccgagagcacacgctat
acctgccccagcgggttatcggcagcgttaaccacccgtatccaggaacaggccttgtat
gctcaccggatattgggatgtaccggatggagcagagtggatctgattctggatgaaaat
gaacaaccttttttccttgaaaccaatacttcgccaggaatgaccgaccacagtctcgtg
ccaatggcggcaaaggcggcaggcatttccttcgatgaactcgttgttcagattctggag
ctgagctgtgagcattga

DBGET integrated database retrieval system