KEGG   Nitrosomonas europaea: NE1658Help
Entry
NE1658            CDS       T00130                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
neu  Nitrosomonas europaea
Brite
KEGG Orthology (KO) [BR:neu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:neu01004]
    NE1658
Enzymes [BR:neu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     NE1658
Lipid biosynthesis proteins [BR:neu01004]
 Acyl-CoA synthetase
  Unknown
   NE1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: CAD85569
UniProt: Q82U49
LinkDB All DBs
Position
complement(1790664..1792496)
Genome map
AA seq 610 aa AA seqDB search
MSSTIAKLGVPPVQKSNSLSSRIDVVVPTPTVNSSPQKRADFTTLVESLEYAAQGETGYN
FYDSRGNLKSVLAYKDLCANSKIIARRLSGLGLARNSRVALIADTTPEFIELFFACRFAG
LVPFAMPVPVNLGSRAIYVQQLRGMLESSKASVAVANLDFVEFLNEAVGSLVSSELKWSG
TPEQLDLLPEADVVFSPNTPDETAYLQFTSGSTRLPRGVVITERALMTNLRGIVCNGLDV
RLGDRCASWLPFYHDMGLVGLVLAPLAAQLSVDYLATRDFAVRPLQWLKLISRNRCTIAF
SQPFGLKLCTLRARESDLADLDLSCWRAAGVGAEMIRMDTLKSFAAKFAAAGFDERAFLP
CYGLAESTLAVSFPDISRGARSLRVDARTLIEKKIAVRVQAEGRKYNEFVNCGRPLPGHE
VRIVDDTDHEVPHMTVGSILVRGGSVMNGYFNNAEETARAIRPDGWLDTGDIGFLFEDDL
YITGRRTDVIIVNGRNIRAQDVEELAEQQPEVRAREASAFGISNEDGSTSVVLVVECRLA
SAVDRQSLINRLQQMVYMAFGVSCLVELVPPHTLPRTSSGKLSRFAARQGFLRRANLEQP
TAATTIHTAG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcgacaatagccaagttgggcgttccgccagtacaaaaaagtaattccctgtct
tccagaatagatgtcgttgtgccaacgcctacagttaattcatcgcctcagaaaagagcg
gattttacaactttggtggagtcgctcgagtatgctgcacaaggggaaactgggtacaat
ttctacgattcgagaggtaatctaaaatctgtacttgcatacaaagacttgtgtgccaac
tcgaaaataatcgcaagacggttatccggtcttggattggcgcgtaacagtcgggttgct
ctgattgccgatactactccggagttcatcgagctgttttttgcatgccggtttgcaggc
cttgttccatttgcgatgccggtacctgtaaatcttggcagtcgtgcaatctatgtacag
caactgagaggtatgcttgagagcagtaaggcaagcgttgcagtcgccaatcttgatttc
gttgaatttctcaatgaggcggttggcagtctggtaagtagcgaacttaaatggagcggt
acacctgaacagcttgatttgctgccggaagctgacgtagtgttttcccccaatacacca
gatgaaaccgcctatctgcaatttacttccggcagcactcgtttgccaagaggggtggtc
attaccgagcgagctttgatgaccaacttgcgcggtatcgtttgcaatggtcttgatgtt
cggctgggtgaccgatgcgcttcatggcttcctttttatcatgatatgggcttggttggt
ctggtattggcccctttggcggcccaattatctgtagattatctggcaacccgggatttt
gcagtccgccccctgcagtggcttaagttaatcagtcgtaatcgctgcactattgctttc
agccaaccatttggtctcaagttatgtacgctgcgtgcccgtgaatcagatttggctgat
ctggatttgagctgctggcgagcggccggtgtcggtgctgagatgatccgaatggataca
ttgaaaagctttgcagctaaatttgctgctgcgggtttcgatgagcgtgcttttctacca
tgctacgggttggctgaatcgacccttgccgtctctttccctgatatcagccggggagca
aggagtttgcgtgtggatgccagaaccctgatcgagaaaaagattgcggtgagagtccag
gcagagggtagaaaatataatgaattcgtgaattgtggtcgcccattaccaggccatgag
gtcagaatagtcgatgacacggatcatgaggtccctcacatgacggtgggaagtattcta
gtcaggggggggagtgtaatgaacgggtatttcaacaacgcagaagagaccgcgagagcg
atcagaccggatggttggttggatacgggtgatattggctttctgttcgaggatgattta
tatattacaggccggcgaacggatgtcattatcgtcaatggtagaaatatacgagctcag
gatgtggaagagctggctgaacaacagccggaagtaagggcacgtgaagcttctgcattt
ggaatcagtaatgaggatggttcgacatcggttgtgctggttgttgaatgcagactcgca
tcggcagtagaccggcaatcgcttatcaatagacttcagcagatggtatatatggcattc
ggggtaagctgtctggttgagttagtaccgccgcatacattgccccggacatcttcagga
aagttgtcacgctttgcagcacgtcagggattcctgcggcgcgcaaatctggaacagccc
actgcagcaacgactattcataccgctggctga

DBGET integrated database retrieval system