KEGG   Candidatus Nitrososphaera evergladensis: NTE_00665Help
Entry
NTE_00665         CDS       T03224                                 

Definition
(GenBank) glycosyl transferase
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
nev  Candidatus Nitrososphaera evergladensis
Pathway
nev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nev00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nev01003]
    NTE_00665
Enzymes [BR:nev01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     NTE_00665
Glycosyltransferases [BR:nev01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   NTE_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 GtrA Glyco_tranf_2_3 Glyco_transf_21 Glyco_tranf_2_2
Motif
Other DBs
NCBI-ProteinID: AIF82745
UniProt: A0A075MNP2
LinkDB All DBs
Position
572658..573827
Genome map
AA seq 389 aa AA seqDB search
MTLQKPLLKLSLILPTYNEAENIIKILESIEDALPETMTSEVIIVDDNSPDDTGKIAEQY
ASQKRGNNRALSLKVIHRATKGGLSSAIVRGIHSAQGEIVVVMDSDFSHPPQIIPEMIKK
LEGSPPVDIVVASRYVRGGSIIGWPFKRRLLSRGATKIAQYGLGVKKVKDPMSGYFAFRR
QIVEGIEFDAIGYKILLEILVKAKNPHVKEVPYTFTNRTSGASKLNLPVIFDYVKSVWRL
YRYGRSISAKEKRASVKFLSKAARFYSVGATGLLVNYASSFILSSLFPNLWYLHASAVGI
LLSITSNFFLNKVWTFEDRGFEIRKTAKQYGLFLGFSTFGALIQIGALYLLVETYHISYP
LSLVLAVLAASSSNFLLNKKWTFNERLLD
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacacttcaaaagccactgttaaagctctcattaatccttcccacatataacgaagct
gagaacattatcaaaattctagaatctatagaggatgctcttcctgagaccatgacctcc
gaggttataatagttgatgacaactctcctgacgacactggtaagatagccgagcaatat
gcaagtcagaaaagaggcaacaacagggcactctcccttaaggtcatacatagggccacc
aagggcgggctgagttctgcgatagtaagggggatacattctgcccaaggtgaaattgtt
gtcgttatggatagcgacttttcacatcctccacagattattccggaaatgataaagaag
ctggagggcagtcccccggtcgatatcgtggtcgcttcccggtatgtgcgcggaggttct
ataattgggtggccttttaagcgccggttgctaagcaggggcgcgaccaaaatcgcccag
tatgggcttggcgtaaaaaaggtcaaagacccgatgtctggttattttgcctttaggcgg
caaatcgtcgaaggcatagaatttgacgcaatagggtacaaaatactgctagagatcctt
gtcaaagcaaaaaacccccacgtcaaagaagttccttacacttttaccaaccgcacatct
ggcgcaagcaagctcaacctccccgtcatctttgactacgtcaaatcagtgtggaggctt
tacagatacgggagatccatctcggcaaaggaaaaacgggcttctgtcaagtttctttca
aaagctgcaaggttctacagcgttggcgccaccggcctgctcgtaaattatgcgtcatca
tttatcctgagcagcctgtttccaaacctgtggtatctgcatgcaagtgcagtcggcatt
ctgctctccatcacttccaactttttcctgaacaaggtgtggacctttgaggatcggggg
tttgaaattcgcaaaacagccaagcagtatggtttattcctgggctttagcacgtttgga
gcgttaatccagatcggcgcattgtatttgttggtagaaacctaccacatcagttaccca
ttgtcactggttctggcggtccttgcagcatcaagcagcaactttctgctgaacaagaaa
tggacgtttaatgagcggcttttggattga

DBGET integrated database retrieval system