KEGG   Nocardia farcinica IFM 10152: NFA_10410Help
Entry
NFA_10410         CDS       T00207                                 

Gene name
echA8
Definition
(GenBank) putative enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00071  Fatty acid degradation
nfa00280  Valine, leucine and isoleucine degradation
nfa00281  Geraniol degradation
nfa00310  Lysine degradation
nfa00360  Phenylalanine metabolism
nfa00362  Benzoate degradation
nfa00380  Tryptophan metabolism
nfa00410  beta-Alanine metabolism
nfa00627  Aminobenzoate degradation
nfa00640  Propanoate metabolism
nfa00650  Butanoate metabolism
nfa00903  Limonene and pinene degradation
nfa00930  Caprolactam degradation
nfa01100  Metabolic pathways
nfa01110  Biosynthesis of secondary metabolites
nfa01120  Microbial metabolism in diverse environments
nfa01130  Biosynthesis of antibiotics
nfa01212  Fatty acid metabolism
Module
nfa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NFA_10410 (echA8)
   00650 Butanoate metabolism
    NFA_10410 (echA8)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NFA_10410 (echA8)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NFA_10410 (echA8)
   00310 Lysine degradation
    NFA_10410 (echA8)
   00360 Phenylalanine metabolism
    NFA_10410 (echA8)
   00380 Tryptophan metabolism
    NFA_10410 (echA8)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NFA_10410 (echA8)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NFA_10410 (echA8)
   00281 Geraniol degradation
    NFA_10410 (echA8)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NFA_10410 (echA8)
   00627 Aminobenzoate degradation
    NFA_10410 (echA8)
   00930 Caprolactam degradation
    NFA_10410 (echA8)
Enzymes [BR:nfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NFA_10410 (echA8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAD55886
NIH_Japan: nfa10410
UniProt: Q5Z105
LinkDB All DBs
Position
1148603..1149397
Genome map
AA seq 264 aa AA seqDB search
MTDFETILLERKPTSAGKGAVGWITLNRPKALNALNAQVLDDVIAALDELERDDEVGAVV
ITGSERAFAAGADIKEMQPKSYMDMFMDDYFARWDRLADFRKPTIAAVAGYALGGGCELA
MICDILIAADTAKFGQPEIKLGVIPGIGGSQRLTRAIGKAKAMDLVLTGRTMDVEEAERA
GLVSRIVPAAELLDTAQQVAETIASMSLPVAMIAKEAVNRSFETTLAEGLRFERRVFHSL
FAIEDQKEGMAAFVEKRPAQFGNR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcgagacgattctgctggagcgcaagcccaccagcgccggtaagggcgcg
gtcgggtggatcacgctgaaccgtcccaaggccctcaacgcgctcaacgcgcaggtcctc
gacgacgtcatcgccgcgctcgacgagctggagcgcgacgacgaggtgggcgcggtcgtg
atcaccggttccgagcgggccttcgccgccggcgccgacatcaaggagatgcagcccaag
tcgtacatggacatgttcatggacgactacttcgcgcgctgggaccggctggccgacttc
cgcaagcccaccatcgccgcggtggcgggctacgcgctcggcggcggctgcgagctggcg
atgatctgcgacatcctcatcgccgccgacaccgccaagttcggccagccggagatcaag
ctcggcgtcatcccgggcatcggcggctcgcagcgcctgacccgtgccatcggcaaggcc
aaggcgatggacctggtactcaccggccgcaccatggacgtcgaggaggccgagcgcgcc
ggactggtgtcgcggatcgtgcccgccgccgagctgctcgacaccgcgcagcaggtcgcc
gagaccatcgcctcgatgtcgctgccggtcgcgatgatcgccaaggaagcggtcaaccgg
tccttcgagaccacgctggccgaggggctgcgcttcgagcggcgggtgttccactcgctg
ttcgccatcgaggaccagaaggagggcatggccgcgttcgtggagaagcggcccgcccag
ttcggcaaccgctga

DBGET integrated database retrieval system