KEGG   Nocardia farcinica IFM 10152: NFA_27070Help
Entry
NFA_27070         CDS       T00207                                 

Gene name
katB
Definition
(GenBank) putative catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00380  Tryptophan metabolism
nfa00630  Glyoxylate and dicarboxylate metabolism
nfa01110  Biosynthesis of secondary metabolites
nfa01130  Biosynthesis of antibiotics
nfa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NFA_27070 (katB)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    NFA_27070 (katB)
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     NFA_27070 (katB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: BAD57554
NIH_Japan: nfa27070
UniProt: Q5YW87
LinkDB All DBs
Position
2871671..2873830
Genome map
AA seq 719 aa AA seqDB search
MTGHTPDTPDNAADADHAAGGADRKQRQLDAHRVDREQGHLTTQQGVRVRHTDDALSAGA
RGPTLLDDFHAREKITHFDHERIPERVVHARGAGAYGYFQPYDDRLAEYTVAKFLTDPAE
RTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTSQGNYDLVGNNFPVFFIQDGIKFPDFV
HAVKPEPHNEIPQAASAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFR
FLDAAGTPTFVKFHWTPKLGVHSLVWDECQQIAGRDPDYNRRDLWDCIEAGHYPEWELGV
QLIPVEKEFDFDFDLLDATKLVPEEQVPVLPVGRMVLDRNPDNFFAETEQVAFHTANLVP
GIDFTDDPLLQLRNFSYLDTQLIRLGGPNFAQIPINRPVADVRNHQQDGYGQHAIPRGQA
SYTVNSIGGGCPVVGGDGSYEHYPRQVDGRAQRRRAESFREYYRQPRMFWRSMSAPEAEH
IVEAFAFELGKVQRVEIRERTLGQLVRIDPDLAVRVAGRLGLPAPPPDPEAGTDAFVSPA
LSQAHTAKDSIATRQVAVLAADGVDAAGVRALRSALTERGAIVEVIASHGGMVHADGGDG
DTLPVDRTLMTVASVLYDGVVVAGGQTGVETLTRNGEAVHFVLEAFKHAKPVAAFGAGVS
LLRIAGILDAARAHDADPATGVITTEARGDGLDEEFVTDLARALANHRTWQRATSAIPA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactgggcacacccccgacacccccgacaatgccgccgacgccgaccacgccgccggc
ggagcggatcgcaagcagcgtcagctcgacgcccaccgggtcgaccgggagcagggccac
ctcaccacccagcagggcgtgcgagtgcgccacaccgacgacgcgctctcggccggagcc
cgcggccccacgctgctcgacgacttccatgccagggagaagatcacccacttcgatcac
gagcgcattcccgaacgcgtggtgcacgcgcgcggcgccggtgcctacggctacttccag
ccctacgacgaccggctggccgaatacaccgtcgcgaagttcctgaccgatcccgccgaa
cgcaccccggtgttcgtgcgcttctccaccgtcgccggttcccgtggttcggccgacacc
gtgcgcgacgtgcgcggtttcgcgaccaagttctacacctcgcagggcaactacgacctg
gtcggcaacaacttcccggtgttcttcatccaggacggcatcaagttccccgacttcgtg
cacgcggtgaaacccgagccgcacaacgagataccgcaggccgcctcggcgcacgacacc
ctgtgggacttcgtgtcgctgcagccggagaccctgcacgcgatcatgtggctgatgtcg
gaccgggcgctgccgcgcagctaccggatgatgcagggcttcggcgtgcacaccttccgg
ttcctcgacgccgcgggcacgccgaccttcgtgaagttccactggacgcccaagctcggg
gtgcactcgctggtgtgggacgaatgccagcagatcgccgggcgcgaccccgactacaac
cgccgcgatctgtgggactgcatcgaggccgggcactatccggagtgggagctgggcgtg
cagctcatcccggtggagaaggagttcgacttcgacttcgacctgctcgacgccaccaag
ctggtccccgaggaacaggtgcccgtgctgccggtgggccggatggtgctcgaccgcaac
ccggacaacttcttcgccgagaccgagcaggtcgccttccacaccgccaacctggtaccg
ggcatcgacttcaccgacgacccgctgctgcaactgcgcaacttctcctatctggacacc
cagctgatccggctcggcggtcccaacttcgcccagatcccgatcaaccgcccggtcgcc
gatgtgcgcaaccaccagcaggacggctacggccagcacgccatcccgcgcgggcaggcg
agctacaccgtcaacagcatcggcggcggctgccccgtcgtgggcggcgacggctcctac
gagcactacccgcggcaggtggacggccgggcgcagcgccggcgcgccgagagcttccgg
gagtactaccggcagccgcggatgttctggcgcagcatgtccgcaccggaggccgaacac
atcgtggaggccttcgccttcgaactcggcaaggtgcagcgggtggagatccgcgagcgc
acgctcggccagctggtgcgcatcgaccccgacctggccgtgcgggtggcgggccggctc
ggtctgcccgcgccgccgccggaccccgaggccggcaccgatgccttcgtctccccggcc
ctctcgcaagcccacaccgccaaggacagcatcgccacccggcaggtcgcggtgctggcc
gccgacggagtggacgcggcgggggtgcgggcgctgcgctcggcgctcaccgaacgcggc
gcgatcgtggaggtgatcgcctcgcacggcggcatggtgcacgccgacggcggcgacggc
gacaccctgccggtcgatcgcacactgatgacggtggcctcggtgctctacgacggcgtc
gtggtcgccggcgggcagaccggggtggagacgctgacacgcaacggcgaggcggtgcat
ttcgtcctcgaggcgttcaagcacgccaaaccggtcgcggcgttcggtgcgggtgtctcg
ctgttgcggatcgcgggcatcctcgacgcggcgcgcgcacacgacgccgacccggctacc
ggtgtgatcaccaccgaggcgcgcggtgacggcctcgacgaggagttcgtgaccgatctg
gcgcgggcactggcgaaccatcggacgtggcagcgggcgacctcggcgattccggcataa

DBGET integrated database retrieval system