KEGG   Nocardia farcinica IFM 10152: NFA_29400Help
Entry
NFA_29400         CDS       T00207                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    NFA_29400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nfa03400]
    NFA_29400
Enzymes [BR:nfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NFA_29400
DNA repair and recombination proteins [BR:nfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NFA_29400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: BAD57787
NIH_Japan: nfa29400
UniProt: Q5YVK4
LinkDB All DBs
Position
complement(3121163..3122125)
Genome map
AA seq 320 aa AA seqDB search
MAPAPSPMLATAGRPPEDPRGWAFEMKWDGMRAVADAADGQCLLYSRNGKQVAGSFPEIV
EAVAAAVGPHRVVLDGEIIAPEGARGAPSFSRLQRRMHVRAPTPQLIREVPVLYMLFDLL
ALDGHATVRLPYTERRDLLARLDIARPPLQLSPSWTDVDPAELAAAATDNGLEGLVAKRL
DSVYQPGERSRAWLKMPFRRTTEAVIAGWLPGNGPFQKSFGSLVLGAHDAQGRLVHIGNV
GTGWKQSERTRLRQRLDEIARPDSPFDVPAPRPVAALAHWVSPELVADIEYREATAEGLR
HPSWRGLRIDKDPAEITWPA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgcgccgtcgccgatgctggccaccgctggacgaccgccggaggatccgcgc
ggttgggctttcgagatgaaatgggacgggatgcgggcggtggccgacgccgccgacggg
cagtgcctgctctacagtcgcaacggcaagcaggtcgccggatcgttccccgagatcgtc
gaggccgtcgcggccgcggtcggcccgcaccgggtggtcctcgacggggagatcatcgcc
cccgaaggcgcccggggcgcgccgtcgttctcccggttgcagcgccgcatgcacgtgcgc
gccccgacaccgcagctcatccgcgaggtgccggtgttgtacatgctgttcgatctgctc
gcgctcgacgggcacgccaccgtgcgcctgccctacaccgagcgccgcgacctgctcgcc
cggctcgacatcgcgcgcccgccgttgcagctgtcgccgagctggaccgatgtcgacccc
gccgagctggccgcggccgccaccgacaacggcctggaagggctggtcgccaaacggctc
gattcggtgtatcagcccggggagcgcagccgcgcctggctcaagatgccgttccgcaga
acgacagaagcggtgatcgccggatggttgccgggtaacggtccgttccagaagtcgttc
gggtcactggttctcggtgcacacgatgcacaggggcggctggtgcacatcggcaacgtc
ggcaccggatggaagcagtccgagcgcacccggttacggcagcggctcgacgaaatcgcc
cgcccggactcaccgttcgacgtgcccgcgccccgcccggtcgccgcgctcgcccactgg
gtctcccccgaactcgtcgccgacatcgaataccgcgaagccaccgccgaaggactgcgc
cacccgagctggcgcgggctgcgcatcgacaaagacccggccgagatcacctggcccgcc
tga

DBGET integrated database retrieval system