KEGG   Nocardia farcinica IFM 10152: NFA_30750Help
Entry
NFA_30750         CDS       T00207                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NFA_30750
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NFA_30750
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NFA_30750
    1.1.1.-  
     NFA_30750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: BAD57922
NIH_Japan: nfa30750
UniProt: Q5YV69
LinkDB All DBs
Position
3260521..3261576
Genome map
AA seq 351 aa AA seqDB search
MRAAVYYGPNKVDVVDVPEPEPGPGEVKLRVGFNGICGTDLHEYYAGPIFVPTEPHPLTH
RQLPLVLGHEFSGTVTEVGSGVTGIEPGDRVAVEPLYTCGHCGPCRAGTYNICRRIGFHG
LMSDGGMAEYTVVPAHMIHRLPDSVPLELGALVEPMSVAYHAATLGDPKPEDTAMVFGAG
PIGIGLWFALRAKGLDDIYVVEPSPTRRAAIEALGATTLDPTAVDVPAFIDNATDGAGAD
ATYDAAGVQPAVETALACLGARRPLISVAIYEKPLTTPLQRLVMNESRIQGSLCYTSADY
RAVIDLMAQGRYDATGWVETIALEQVIDEGFEALHAGTKMKVLVDPAEVAA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagctgtgtactacggcccgaacaaggtcgacgtcgtcgacgtaccggaaccc
gagccggggcccggcgaggtgaaactacgggtgggcttcaacggcatctgcggcaccgac
ctgcacgagtactacgccgggccgatcttcgtgcccaccgaaccgcatccgctcacccac
cggcagctgccgctcgtgctcgggcacgagttctccggcacggtcaccgaggtcggcagc
ggtgtcaccggcatcgagcccggcgaccgggtcgccgtcgaaccgctctacacctgcggc
cattgcggcccctgccgggcgggcacctacaacatctgccgccggatcggtttccacggc
ctgatgtccgacggcggcatggccgaatacaccgtggtcccggcccacatgatccatcgg
ctgccggactcggtgccgctcgagctcggcgcgctcgtggagccgatgtcggtggcctac
cacgccgccacgctcggtgatcccaaaccggaggacaccgccatggtcttcggcgccgga
ccgatcggcatcgggctctggttcgcgttgcgcgccaagggcctcgacgacatctacgtc
gtggaaccgtcgcccacccgccgcgccgcgatcgaagcgctcggcgccaccaccctcgac
ccgaccgcggtcgacgtccccgcgttcatcgacaacgccaccgacggcgcgggcgccgac
gcgacctacgacgccgcgggcgtgcaacccgcggtcgagaccgccctggcgtgcctgggc
gcgcgccggccgctgatcagcgtcgccatctacgagaagccgctgaccacaccgctgcaa
cggctcgtcatgaacgaatcccgcatccagggctcgctgtgctacacctccgccgactac
cgcgcggtcatcgacctcatggcgcagggccgctacgacgccaccggctgggtggagacg
atcgccctcgagcaggtcatcgacgagggcttcgaggcgctgcacgcgggcaccaagatg
aaggtgctcgtcgatccggcggaggtggcggcatga

DBGET integrated database retrieval system