KEGG   Nocardia farcinica IFM 10152: NFA_35400Help
Entry
NFA_35400         CDS       T00207                                 

Definition
(GenBank) putative glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00250  Alanine, aspartate and glutamate metabolism
nfa00410  beta-Alanine metabolism
nfa00430  Taurine and hypotaurine metabolism
nfa00650  Butanoate metabolism
nfa01100  Metabolic pathways
nfa01110  Biosynthesis of secondary metabolites
nfa01120  Microbial metabolism in diverse environments
nfa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    NFA_35400
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NFA_35400
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NFA_35400
   00430 Taurine and hypotaurine metabolism
    NFA_35400
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NFA_35400
Enzymes [BR:nfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NFA_35400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAD58388
NIH_Japan: nfa35400
UniProt: Q5YTV3
LinkDB All DBs
Position
3750791..3752206
Genome map
AA seq 471 aa AA seqDB search
MPLSHPSFPQDPGPSEVAVNPVFTREPVSVPRDRLPAGELDADIAYQVVHDELMLDGNAR
LNLATFVTTWMEPSARVLMAECFDKNMIDKDEYPRTADLEQRCVRMLADLWHAADPAHAT
GCSTTGSSEACMLAGLALKRRWQHRRRAAGLSTERPNLVMGANVQVCWEKFADYWDVEAR
LVPMAGDRFHLTAEAALPHCDENTIGVVAVLGSTFDGSYEPVAEICAALDELERQRGWDI
PVHVDGASGAMVAPFCDPDLVWDFRLPRVASVNTSGHKYGLVYPGVGWVVWRDAAALPED
LIFRVNYLGGQMPTFALNFSRPGAQVVAQYYTFLRLGRSGYTRVQQYCRDVATRLADRIA
ALGAFRLLTDGRQLPVFAFTLAEGETGYSVFDVSAALREQGWLVPAYTFPADREDLAVLR
IVVRNGFSHDLADMLLDALAAVLPRLRAQDRPQHGPDTATFAHGAQAPSGH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgtcgcacccctcctttccgcaggatcccgggccgagcgaggtggccgtcaat
cccgtcttcacccgcgaaccggtgtcggtgccgcgggatcggctacccgcgggcgaactc
gacgccgatatcgcctaccaggtggtgcacgacgagttgatgctcgacggcaacgcccgg
ctgaacctggccaccttcgtcaccacgtggatggagccgagcgcgcgggtgctcatggcg
gagtgcttcgacaagaacatgatcgacaaggacgaatacccgcgcaccgccgacctcgag
cagcgctgcgtgcgcatgctcgccgacctctggcacgctgccgatcccgcccacgccacc
ggctgttcgaccaccggttccagcgaggcgtgcatgctggccgggctggcgttgaaacgg
cgctggcagcaccggcgccgggcggccgggttgtccaccgagcgcccgaatctggtgatg
ggagccaatgttcaggtctgctgggagaagttcgccgactactgggatgtggaagccagg
ctggtgccgatggcgggcgaccgcttccacctgaccgcggaggcggcgctgccgcactgc
gacgagaacaccatcggcgtggtcgcggtgctcggctcgaccttcgacggcagttacgaa
ccggttgccgagatctgcgccgcgctcgacgagctggaacggcagcgcggctgggacatc
ccggtgcacgtcgacggcgcctccggcgcgatggtcgcgccgttctgcgacccggatctg
gtgtgggacttccggttgccgcgggtcgcctccgtcaacacctccgggcacaagtacggg
ctggtgtaccccggggtgggctgggtggtgtggcgcgacgccgcggcgttgccggaggac
ctcatcttccgggtcaactacctcggcggccagatgcccaccttcgcgctgaacttctcc
cgcccgggcgcgcaggtcgtcgcccagtactacaccttcctgcggctgggtcgcagcggc
tacacgcgggtccagcagtactgccgcgacgtggcgacccgcctcgccgaccggatcgcc
gccctgggcgcgttccggttgctcaccgacggccgccagctgccggtcttcgcgttcacc
ctcgccgagggcgaaaccggctactcggtgttcgacgtctccgccgcgttgcgcgaacag
ggttggctggtgcccgcctacacctttcccgccgaccgcgaggatctggccgtcctgcgc
atcgtggtccgcaacggattcagccacgacctggccgacatgctgctcgacgccctggcc
gccgtcctcccccgcctgcgcgcccaggaccggccccagcacggcccggacaccgccacc
ttcgcccacggcgcccaggccccgagcggccactga

DBGET integrated database retrieval system