KEGG   Nocardia farcinica IFM 10152: NFA_53440Help
Entry
NFA_53440         CDS       T00207                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
nfa  Nocardia farcinica IFM 10152
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nfa01001]
    NFA_53440
Enzymes [BR:nfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NFA_53440
Protein kinases [BR:nfa01001]
 Serine/threonine kinases: Other
  Bacterial family
   NFA_53440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase Pkinase_Tyr TPR_16 TPR_19 RIO1 DZR
Motif
Other DBs
NCBI-ProteinID: BAD60196
NIH_Japan: nfa53440
UniProt: Q5YNP5
LinkDB All DBs
Position
5649229..5651580
Genome map
AA seq 783 aa AA seqDB search
MTALAARPVASRDTPEPPAVPVDPAATGWTPGPADESHTPHPFEDDDGPGTRAVAPTGAM
DRPDSGGARTTSGRSVRTSRSRPTVRRLGGGLVPVPPVPPADPLAAVLTDPVVAESRRYC
GRCTNPVGRATAAHAASTTGFCERCGAPYDFRPSLHAGDMVAGQYEIQGCLAHGGLGWIY
LAIDRNVSDRWVVLKGLLHAGDAEAQAVAVAERQFLAEVAHPSIVKIHNFVEHPGRDGVP
IGYIVMEYVGGRSLRALLDDHRRPQRMPVTEAIAYLLEILPALEYLHSIGLAYNDLKPDN
IMVTEDQVKLIDLGAVTPLEAYGNLYGTKGFQAPEIATTGPTVATDIYTVGRTLAVLTLD
LPMEHGRYRDGIPDPDQHQVLRRYEFFHRLLLCATDPDPARRFPSARAMSAQLAGVLREI
LALDTGAEHPQLSTVFSPQRAGFGTEELISQTDAYADGAGRDPRLSAADVAAALPIPLID
PGEPAAALLAAAMQPDPARALDALGEARARAEADPDTAPDTLGVELTLAEVRIRLDMGDA
AAALRLLARLDAGDWRVHWYTGLAELREQHYESAFAAFEDVLRVLPGEIAPKLALAATAE
LVLQHWETADPEQWRSYAEKYYETVWRTDRAVVSAAFGLARQLAAAGRVDTAVRALDEVP
AASRAYTTARLTAVWLLLTAAPIDELPESTLHVAAARVQTLPAGEARALQLRVLVLGAAL
AWLRAGHEPERADATFFGAPFTERDLREGTEAGLRALARAAPGRDHRYALVDLANSIRAK
TWF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgctcgccgcccggcccgtcgcgtcgcgcgatacgcccgagccgcctgccgtg
cccgtcgacccggccgcgaccggctggacgcccggccccgcggacgaatcgcacaccccg
cacccgttcgaggacgacgacggccccggcacccgggccgtggcgccgacgggcgcgatg
gaccgccccgattccggcggtgcccggacgacatcgggccgcagcgtgcgaacgtcccgg
tcccggcccacggtgcgcaggctcggcggcggtctggtgccggtgccgcccgtgccgccc
gccgacccgctggcggccgtgctcaccgatccggtcgtcgccgagagcaggcgctactgc
gggcgctgcaccaatccggtcggccgcgcgacggccgcgcacgcggcgagcaccaccggt
ttctgcgaacgctgcggcgcgccctacgatttccgcccctcgctgcacgccggtgacatg
gtggccggccagtacgagatccagggctgtctcgcgcacggcgggctcggctggatctat
ctggcgatcgaccggaacgtgagcgaccgctgggtggtgctcaagggtctgctgcacgcc
ggtgacgcggaggcgcaggcggtcgcggtggccgagcggcagttcctggccgaggtcgcg
cacccgagcatcgtcaagatccacaacttcgtcgagcacccgggccgggacggcgtgccg
atcggctacatcgtgatggagtacgtgggcggccggtcgctgcgcgcgctgctcgacgac
caccggcggccgcagcggatgccggtcaccgaggccatcgcctacctgctggagatcctg
cccgcgctggaatacctgcattcgatcgggctggcctacaacgacctcaagccggacaac
atcatggtcaccgaggaccaggtgaagctcatcgacctgggcgccgtcaccccgctggaa
gcgtacgggaacctgtacggcaccaagggcttccaagcgccggagatcgcgaccaccggt
cccacggtcgccaccgacatctacaccgtcggccgcacgctggcggtgctcaccctcgac
ctgccgatggagcacggccgctaccgcgacggcatccccgatcccgaccagcaccaggtg
ctgcgccgctacgagttcttccaccggctgctgctgtgcgcgaccgaccccgatccggcc
cgccgcttcccgtccgcccgtgcgatgtcggcccagctggccggggtgctgcgggaaatc
ctcgcgctggacaccggcgccgaacatccacagctgtccacagtgttcagtccacagcgc
gccgggttcggcaccgaggagctgatcagccagaccgacgcctacgccgatggcgccggg
cgggatccgcggctgtccgcggccgacgtggccgccgcgctgcccatcccgttgatcgat
ccgggcgagcccgccgcggcgctgctggccgccgccatgcaacccgatccggctcgggcg
ctcgacgcgctgggcgaggcccgcgcccgcgccgaggccgacccggacaccgccccggac
accctgggcgtcgagctgacgctggccgaggtccgcatccggctggacatgggcgatgcc
gccgccgcgctgcggctgctggcccggctcgacgccggtgactggcgggtgcactggtac
accgggctcgccgaactgcgcgagcagcactacgagtcggccttcgccgcgttcgaggac
gtgctgcgggtactgcccggcgagatcgcgcccaagctcgccctcgccgccaccgccgaa
ctggtcctacagcactgggagacggccgatccggagcagtggcgcagttacgcggagaag
tactacgaaaccgtttggcgcaccgaccgtgcggtggtgagcgcggcgttcggcctggcg
cggcaactggccgccgcgggccgggtggacacggccgtgcgcgccctcgacgaggtgccc
gccgcctcccgcgcctacaccacggcccgcctcaccgccgtgtggttgctgctcaccgcg
gcgccgatcgatgaactgcccgagtcgaccctgcatgtcgccgcggcccgggtgcagacc
ctgccggccggggaggccagggcgctccagctgcgcgtgctggtgctcggcgccgcgctg
gcctggctccgcgcgggccacgaacccgaacgcgccgacgccacgttcttcggcgccccg
ttcaccgaacgggacctgcgcgagggcaccgaggcgggcctgcgcgccctggcccgcgcc
gccccggggcgcgaccatcgctacgccctggtcgacctggccaactccatccgggcgaag
acctggttctga

DBGET integrated database retrieval system