KEGG   Nocardia farcinica IFM 10152: NFA_54770Help
Entry
NFA_54770         CDS       T00207                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00010  Glycolysis / Gluconeogenesis
nfa00053  Ascorbate and aldarate metabolism
nfa00071  Fatty acid degradation
nfa00280  Valine, leucine and isoleucine degradation
nfa00310  Lysine degradation
nfa00330  Arginine and proline metabolism
nfa00340  Histidine metabolism
nfa00380  Tryptophan metabolism
nfa00410  beta-Alanine metabolism
nfa00561  Glycerolipid metabolism
nfa00620  Pyruvate metabolism
nfa00625  Chloroalkane and chloroalkene degradation
nfa00903  Limonene and pinene degradation
nfa01100  Metabolic pathways
nfa01110  Biosynthesis of secondary metabolites
nfa01120  Microbial metabolism in diverse environments
nfa01130  Biosynthesis of antibiotics
Module
nfa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFA_54770
   00053 Ascorbate and aldarate metabolism
    NFA_54770
   00620 Pyruvate metabolism
    NFA_54770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NFA_54770
   00561 Glycerolipid metabolism
    NFA_54770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NFA_54770
   00310 Lysine degradation
    NFA_54770
   00330 Arginine and proline metabolism
    NFA_54770
   00340 Histidine metabolism
    NFA_54770
   00380 Tryptophan metabolism
    NFA_54770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NFA_54770
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NFA_54770
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NFA_54770
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     NFA_54770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAD60329
NIH_Japan: nfa54770
UniProt: Q5YNB2
LinkDB All DBs
Position
5801180..5802625
Genome map
AA seq 481 aa AA seqDB search
MHYDSLFIGGRWTEPAGSERLQVISPATVEPVGSVPVVERADVDAAVTAARHAFDHGPWP
STPPTERAAVLTKAARLIEQRSGDLVAALTAEMGAPGMAAMTLNQLPATATLDTYAALAQ
TFPWTETRTGSFGTTRVSREPRGVVAAVTAWNVPLFLAVNKLAPALLAGCTVVLKPAPLT
PLTANMIADIFTEAGVPEGVISVLPAEAEVAEYLIAHPGVDKVTFTGSTPVGRRIAAIAG
EQLKSVSLELGGKSAAILLEDMDVAANIPVLAFSGLMNSGQGCVAQTRILAPRSRYDEIL
DALVEHVRTLKTGDPNDPSVTFGPLISERQRERVEGYIAKGKAEGARLVLGGGRPAGLDR
GWFVEPTIFADVDNKSTIAQEEIFGPVLSVIPYETEDEAVAIANDSAYGLAGSVWTTDVE
HGAAVAARVRTGTYAINWYAFDPTAPFGGYKNSGLGRENGPEGLDSFCEQKSLLMPMGWT
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcattacgacagcttgttcatcggcggccgctggaccgaaccggccggctccgagcgc
cttcaggtcatctcgcctgccacggtagagccggtgggcagcgtcccggtcgtggaacgc
gccgacgtcgacgcggcggtcacggccgctcggcatgccttcgatcacggcccgtggccg
tccaccccgcccaccgagcgcgcggcggtgttgaccaaggccgcccgcctgatcgagcag
cgctccggcgatctggtcgccgccctcaccgcggagatgggcgcgcccggcatggccgcg
atgaccctcaaccagctcccggccacggccaccctcgacacctacgccgcactggcgcag
acgttcccgtggaccgagacccgcaccggctccttcggcaccacccgcgtcagccgcgaa
ccgcgcggcgtggtggcggccgtgacggcctggaacgtgccgctgttcctggcggtcaac
aagctcgcccccgccctgctcgccgggtgcacggtggtgctcaagcccgcaccgctgacc
ccgctgacggccaacatgatcgccgacatcttcaccgaggcgggcgtgccggagggcgtc
atctcggtactgcccgccgaggccgaggtcgccgagtacctgatcgcccaccccggcgtc
gacaaggtcaccttcaccggcagcaccccggtcggccgccgcatcgccgccatcgccggg
gaacagctcaagagcgtctccctcgaactgggcggcaagtccgccgcgatcctgctcgag
gacatggacgtggccgccaacatcccggtactcgccttctccgggctgatgaacagcggg
cagggctgcgtcgcgcagaccaggatcctggcgccgcgcagccggtacgacgagatcctc
gacgcgctggtcgagcacgtgcgcacgctgaagaccggcgacccgaacgatccgtcggtg
accttcggcccgctgatctccgagcgccagcgtgagcgggtggagggctacatcgccaag
ggcaaggccgagggcgcgcgactggtgctcggcggcggcaggcccgcggggctcgaccgc
ggctggttcgtggagccgaccatcttcgccgacgtcgacaacaagtcgaccatcgcgcag
gaggagatcttcggcccggtgctctcggtgatcccctacgagaccgaggacgaggccgtg
gccatcgccaacgactccgcctacggcctggccggttcggtgtggaccaccgacgtcgag
cacggcgccgccgtcgccgcgcgggtgcgcaccggcacctacgcgatcaactggtacgcc
ttcgacccgacggcaccgttcggcggctacaagaactcgggtctgggacgcgagaacggg
cccgagggtctcgactcgttctgcgagcagaagtcgctgctgatgccgatgggctggacc
ggctag

DBGET integrated database retrieval system