KEGG   Nocardia farcinica IFM 10152: NFA_8110Help
Entry
NFA_8110          CDS       T00207                                 

Definition
(GenBank) hypothetical protein
Organism
nfa  Nocardia farcinica IFM 10152
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAD55656
NIH_Japan: nfa8110
UniProt: Q5Z1N5
LinkDB All DBs
Position
878817..900395
Genome map
AA seq 7192 aa AA seqDB search
MAELPGYLRWLEWVAGSDWPAGEPEGMWGIADDWRTAAQGLREILDDIDAAKSASLAAYP
QGEGIDKMVTMFDDLRSGDQSLEKLAENFDLIAESADGVGTEIEYAQLMMITSLAILAAE
IAAAWIFPPTAPAVQAAAIGVTRVGIRMLAQQVMNRIIQWTARLVGRKVATFLVRHMAID
TFIGTFQEVGIQAYQVEFGRRPDINWEQVAVTAVSSAAGGAAASPFGDWIAKKLPAAMPN
WLSGAVTGATAGAVGAGAGFAASVATQFGIDAYQDGWDKAWENAKNTEFDPRMLTAGVSN
GAMSGASRAMADGFYHNRHPEWYPAPSQDPPRPEPRIGGTPPGFDPAGNGTDPGGTGNAD
GGHTNGTGPVGGNQNGTDPAGSTGAGADRAGIAPETTAPGTAAPEAGPAGEPASQTSPAA
GATPPETGAADPTTPRGEGSTAPADGETAPGRAADHAPPDEGGAGTRGESDGEGRTDADG
RPAVDADTAGDGRGETDGEATRSGSDPSTPGDRAATPESADGGARTAALEASPAAAPSDT
GAVPGADAAAGAPRPDAAFEASPAAAPSDTGADAAAPRSDAEEASPAAIQSDTGAPRGDT
AAPRDAGHPSTSAPEGPTGGSADGTAAPRVLDGTAPARPDSAPQPTGTAFGFPGAAPISG
ATPPPGALPAAAPPSAVTPGTGAAPASSTPGTTPGTGSSPAGSLAQHTPGQHGTDRPSAP
GESRQTPGPAARPSAAPAARAGIADGTSPFGREGGVQARHADAPAPLAERSVAQDVSSED
AESVQVPPEGMLAVPPLVADLAAPRAGRTDSADRPASRPTPEDSDRVAGDDRARPSRAGT
DAPTTPRADDPNRDGGTSSDPDRVGAPHHDSDPARRGRCAPLSLGEIADATGSTSIRVPE
HVGPEGLSAAELEHYAGGRLHGVPTPADPAAPRHQALADLLLSEDNLATWALVVDEYRGP
VDEYGVGAHAYVLSVQVDPATGARSVVVSDPATGVRRGFPPVVPPELGRVHAILFDAGGH
ALPEDAAHPLADLIGEGGARIGRSADEHRDQIRELLALTPTGRDILATLDSGPVRDAYER
GAEDGRVGSFRRGALAAVAFTEGNSHLRQALALAHESVHAQRFVDGQTAHTRDGMRSMSR
DDYVRAMIEEEAAATGRRFQLARELRTLGFDIPTNQLEAVYTDAYERAELGLSRSEPELP
PAEVARIAHEVAVDALRGPLAHYEFDNGVTYTRFYGEAWDRVRLPPAHGADAPNADLVFR
PTDAGVVQDLRRAVLALRADLLALEDISQRLTALAATVDVDATAPRQVFDARIAERLADL
AAGGRARDSDPARAAELRRVEHDLRTLSGLADQRDAAQRAVDERSRDLGLRAAREYVHAR
AESTPDARVLTDQIVLVPGEPDRVLVAAPPGEHPAVLDGARTDPELAALLDRAEVEPFEV
RVDNDGRVLLDAVDPRAMPGADPRPSPEGSADRPEGAVAPRDPAGAAADARIARVRAELG
TTEVGRWADDVLDRAGVQVVYGSDGADRYLPARRTLRLDVGATDAEQMVALVHGAIHADT
AHARDTPGGARERMLLPRAEYVGRMLDEETRAHALEIVARLQLRAAGHDLPVTDLERAYT
RAFDAARAAAVREHPDAPAHDLDRRANEAGLRALRPLVADLPADPTGITYGEAYGADWDR
SHGIRPFDALVRTALAAGEVSAQIRHEGTSVNSARRVELVTFTDGTQLIRKTMINSRHAD
AEQLFSALARAVGAPVPEVFRAGRNVVYLRPVPGVTAHQRWPGFLDPHELGALDSDAGRA
LGLADALAGVPDRDASGWMVDSDGGIHGIGNHRAFEGTVTPATLSPFASHFLRATADGAL
EPVEHPLTDREMADLRERVAALRPEFERLGRPRWLDGALATLDALAEHARPAPPPDPGLP
VDAGEDDLVYVNRYGGTGRHGISGVVDADGVLHYEIRAGRATPSGREMFADMMRELGHAV
RAIEDDWFAEGGFDDQLATFNAAIQDTFATPEEAALSTFTGRLAAELGFTRVEFGPDGLE
GPLGENTAVTVRFLRPEEALPAPDLRPSEGGRTDRPLGMPPFTSRDTDNPTRPVDRDRGT
DAVDPPEFPAERGAGDADADRAAAAQQRRAELDRLAADRDAAVRDREHALAAGDRERAEA
ARERIDRLGEQIGAAIERDALAGVDARPLTDRVGVIDGARPVVVVANRGGADVRALLAEA
AGRHPELARLLADPEVTVRELRIDESGRVAVVRVENPGPVGRSDDPGAPSAPAETPPLAA
DGGAGKPPSEPPVSAGPDPGEPDPGAGSTRRDWTADGPARTHQPTTDRARRDLAGAGERI
ADAVATRRMAEERLADLARQAGIDPDGRTPHQLSRLADDLLAAAEARVDALHGRTAVPRE
EIVRYFDELRAAQAELGRTVRAVGALRAEVGRWTAAARAEDEARTTAGVLAARDVLTAEG
TRMISEGVGLAPDGQRVVVASPLTRPDAVMPAEVRRMLADRGVAVDYRLVAVDAAGRVTV
TDLRPPAAEAEPATGPESARPDPARSAAEPRPRVRQPDTSAEQPVRPRPAGPDTDVTPEP
TAPPARPDGGPDDYGALLRDRAALASEREFWRAKRDDRADRLGLADPDRELGPDRLEPTL
QRLLGEVVGTRETAGTGEELPGRTPELVGSAELSQRRERIFRLQDAAERFIAASDALAEV
DRRIAALEAAGAGAGRHPTAEVAAELDRLGRERAGQVLALKPWRVMRDDIAARLRVDPDR
LGPEDLPATLDEVANRRVRADEIELRMRNLRLLAEAAEQVNRRENEIGRVQDRITELAGS
ARALFDAAGARPITDRVGLVDGPNPRIVVVGPRGRWDAPFADHDAALAEALRRSGAVAQA
MVRPETTIEYRQIVADRDGTWQPVDLAPPRREFIDAPPSNGRPGIHLTRWRDGDGEWHHV
DTARPDWSAGRDESGVPKKFEPRDLPEGVSGWAVNPFQAAVVDPFVDPSGGTPAGAINES
FLPTIPGGMPPGDIPSYSLPFADAFYHTMRIILESAKLSGFTWYSDSEHPGRIRPGFKGH
PWFRAPRADVQPMVREWNAADRIPDDGNLTRPFLDRQEAARQRWARVQAWADEQYRTFRA
DDSDITRIADNLADRAAADRIAHARELIDRVRAVLRGDAEVDALVDDLTGALADERPGDA
ARLVADLLDVVGRPMDPADHAEVTRLVADQLADRGPTFTAEDIERIKNHLMRDEHLIRDP
HDGTLVRRPLDAVADVAEAWHRLLAGEPLPQDILLLQDARAESDFLRDNPIATWRDANQH
AISLGYDWNADRPPLTDWRANIPYAPAPVGPQAPPAAGPPASRPESSEEQPGRPPATPAP
ATPEPPDDSASPPHPEAEATRPELPPAPPELPTSRAEPQPTRGERPPTQPALTPPVPAES
AGVSETRPDTALPAAVSDPVEGMPSADDGRASAAPARSRSVVPEETGSPTTESNGGAGRP
PSDPPTRGAPDPDEPSEWLRARLAEQEEWNARMRAELAEWAARMRDGAVAREFEGLQREI
DDAFAAIDRRLAEHRAAEQRRTEEFFADLARRAGLPWSTEEPATRPDAEPPPAGADAGRP
PDDDAVPNRTDPADDSRPPVPTPDEPSEWLRARLAEQEEWNARMRAELAEWAARMRDGAV
AREFDGIQREIDAAFDDIERRLAEQRADERRRNDEFFDELLRRVALPWAPADPATEGQVD
PRRGSEDDPDNRAETPTGGEHHTRDDGAHHPERGGRRDDPTDPEDGTDGAAGHPADPPSR
PPAAPSAAAPESVPDQVAPVPEDERSTGELAAGDSAERDGPAAWSPVGPGQEVAPPSEAV
ARELRALGERAAAAAARRADIERQLLRQVGELPIDRADLSVEEVVRAAEEHLREARARED
ELRDGWDVALDEVDGHQRAVAEAAHLADRAGRVVEAIRAAIRERAEAIRAEHDARMTAGV
LAARAVLDAEGVRMIGEGVGLSPDGRRVLIASPLADPGVLLPPETRALLARNNVEIDYRL
VEVDGAGRITATPIAPPRTPETWSTPESTAEAPPSREPDEHRSRLREQLDGLRERRAEAA
DRAERLRDEIADLARSTADDPTTDAATTEADVVARRVRDLAEAEAEVARLDEMLDYLRTA
ATPDTDHEALLREQARLTSEREFWRAKRDDRADRLGLADPDRELGPDRLEPTLQRLLGEV
VGTRETAGTGEELPGRTPELVGSAELSQRRERIFRLQDAAERFIAASDALAEVDRRIAAL
EAARGLPDRSRAAEVAAQLEQLGRERAGQVLALKPWRVMRDDIAARLRVDPDRLGPEDLT
ATLDEVAGRQVRADELELRARNLELLAEAADQVNRRENEIGRLQDRMAELAGADREIFDT
AGARGITDRVGLVDGPNPRIVVVGPRGRWDAPFADHDAALADALRHSAAVAQAMVRPETT
IEYRQIVADRDGTWQPVDLPSPRREFVDAPPRNGGPGIHLTRWRDGAGEWHEVNTSRPDW
STGRDESGVPKKFEPRDLPEGVSGWAVNPFQAAVVDPFVDPSGGTPAGAVNESFLPTIPG
GMPPGDVPSYSLPFADVFYHTMRIILESAKLSGFTWYSDSANPGRIRPGFKGHPWFRAPR
PDVQPMVREWNAADRIPDDGNLGPEYRARQQAAREQWARVQAWADEQYRIFRDMGADDLA
AIFDNLTEAARADRAARAQDLIQRLRELAAQDDPDVEAVIAELTGTLPDEQPGDAARLVT
DLLAVVGRPADALRPDELVELVAQQLGADEPEFTWEELQRIKNHLMHDEHLIRDPEDGTL
VRRRLDAVADVAEAWHRLMNGDHLPQDLLLLRDARAESDFLRDNPIATWRDANQHAISLG
YDWNADRPPLTDWRANIPYAPAPVGPQAPPTRPTPPPIPPSTPGNAASPGPGADHRTRPA
DTAPHRPSEAATTPADDPAALSPEITGDGGESGPRPARPDGTIRADDRAALSPEGIADDG
ESGPQPARPDGTTDDRAAPSPEVTGEYGETSPARPDGTIRTEEPPPDEDEGDDPPAAAPP
AGPPSQPPAAPPAAGDPGDPGDEGDAHRARESATAAESTDSASRDAPPEARGADASSEST
DRVDTSETTPVDPAPEPRPAAPTRPAADPTAPPAADTQSQRRDAVPNRLAADIEAAVRER
DAARTAGDDRAVEATTERIERLAGALLSANAQHALRAAGAHLVGSRVGVLGGEPPRYLVA
GWGGADTGAALADALAADPALAELLRLPGVEIRELRLTIDENGAIGAHLVDPPASAADRG
DQTADRDTVGQPPATAPESDAPQRDHTRVGAGEPANPGDDPARDSADDPGTRDSAQAEAR
RAHAEALARRDELAARIRELGERLPIREPEALDPDHIAATVRELSTWNLSEPDQVAALAE
LVDLVPGFLEAHADAALLAARIGLLDDYDRLLAEHKELVREREFVRAKADERAEHLLGTD
DPPWTTRDSDSRDDAIRARYAEARTDLIDIPAGPDEVGHQERRLADPDDVRERRRALEKL
IETTGRFDDLAEQVRQVEQRLADLENAGIAQYRPPTAEVADRLDTLARERAAELRRIKPR
RAMRDDLALRLGVVDDTGAPDEPALSRDLDRTLADLRARVAADLRSGALPVNELPARLRA
IAALADAAPEVARAHNRIGRLQDEMAGLAGAWRTQIEAEGGRMVTDRVGIVEGERPRIVV
FGPRPDPESPRAEHDRAFEAALRTAAPVAQAVVRPETTVEYRRVLADRQGEVRSETMPPP
EVERLSAGGVGGRRLDMTQWRDAEGTWHPVDPTRPDWTTGRDSGTLPKKFTPKDPPDGVS
GWAMEDVVNDITLPTDDVPPGQIPESTLPVNAPMAPSQYSTGGVPDGATVFGQHWGADSY
NVVRLILMAAQVPKHPAVQAWFQRHPEIGRWVQARPWLRHIPPFGTVFRDYQWFAPPERN
VQPMFRAWDVADHAPPAERVDIPDGLRAEWDREVADWQRVQDWADSEYERFLADDSDIDA
IVEGLDAHRRDRQRELAREVVDAVRAELVDRHRGIDPVGDIDAQLAMVAADIDRVAADLA
DRFAAADPPAVRSTVEDIRELLLAPDQPASFAAELRPGETPEDAIARLLAEHMRDDVPVF
TREQIQQIKDHLMRDEHRVRDHTDPGGGYVRRPMDRLADVAEAWHRLSTGRPLPQDFVLL
RDALAESEFLRRHPTAGWREANTHAVGLGHHWDADRPPLTDWRAGIPYAPAPLPVDPGWT
PPGERGTALPAPDGPETGPPGGRSAQLPPGETARPGDPATDGAPPHPGDRRVWPPEPPTP
RDSADTEADESTTQSRSPGPPADSQHSDPITEADAPHRPAETPSPESTTGSGQFSADQGH
RQARDRVEAARPVGGREPGEVPDSAEGPQVPDGGEPGDASATEGSAVPRTGSTLGAESES
ESESESESESESESESEPGVRHDGDDPDGAAGRRSTGPDAEEGAVRSEGDMRTDGDRRSD
GAPSDGAARTDGDARSDGDVRPDGDAGTDSDAGTDGDAGTDSDARPDGDARTEGNARTEV
DARTEGDARTDGGARTVGDARTEGNAPPEGDARPDGDARTDGQTRSEGDADQGDRARGAD
GGPHEPGAGEGPAASRPPRLPGSSMRSHIPHPPKDHDIELPPTGTIPPRDPGPWPLPDPP
TEPGPGDPPHDPPHDPPGSDCPPTPPATDCPLPPAADCPPPATDCPPPPGADSPPAQSTP
VPPAAPTPDPSCPPAPAEPDPPCPPDGTRPPGQQLPPGTCPSGGWSPGEVPSGGWSPGEV
PSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEV
PSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPSGGWSPGEVPPGGWFPGEV
PPDGWFPGAIPPGDRPSHPGPAGPGDVPGPGSQPPANGWQPPHAPQPNGAPPGTPHTPNT
PGRWNPPDSWLPPGAGPNGPTSGATPGTGAPTQGGERPDRWPANGSGGRPHGTPTPPPVQ
DQSQPATAAPMMPPGVPGMPGASAHPAGAARRRGADGYRPPDAAEPTTLLVRPHSGFGVS
AEFDPETGALQATSLRTGVESGVYGELAGVPVVLYRHDSRLRARVGQQSIDLDGPVTVNW
VAGAQRQTTFTISAGETVLCTLTYRTVPAELDIGRFIREVWADPDRRARMFA
NT seq 21579 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctgcctggttatctccggtggctggagtgggtcgcgggctcggactggccc
gccggtgagcccgaggggatgtgggggatcgccgacgactggcgcacggccgcccagggg
ttgcgcgagatcctcgacgacatcgacgccgccaagagcgcctccctcgccgcgtatccg
cagggcgagggcatcgacaagatggtcacgatgttcgacgacctgcgcagcggcgatcag
tcgctggaaaagctcgccgagaacttcgacctcatcgccgaatccgcggacggtgtgggc
accgagatcgaatacgcccagctgatgatgatcacgtcgctggcgattctggcggccgag
atcgcggccgcgtggatcttcccgccgaccgcgcccgccgtgcaggccgccgccatcggt
gtcacccgggtgggtatccgcatgctggcccagcaggtgatgaaccggatcatccagtgg
acggcacgcctggtcgggcgcaaggtggccacattcctggtgcggcacatggccatcgac
accttcatcggcactttccaggaagtcggcatccaggcctaccaggtcgaattcggccgc
aggcccgacatcaactgggagcaggtcgccgtcaccgccgtcagctcggcggcgggcggc
gcggcggcgagcccgttcggcgactggatcgccaagaagctgcccgccgccatgccgaat
tggctcagcggcgcggtcaccggtgccacggcgggcgcggtgggcgcgggcgcgggtttc
gccgcgagcgtggcgacccagttcggcatcgacgcctaccaggacggctgggacaaggcc
tgggagaacgccaagaacaccgagttcgacccgcgcatgctcaccgcgggcgtctccaac
ggtgcgatgtcgggtgcgagccgggcgatggcggacggcttctaccacaaccggcatccg
gagtggtatcccgcgccgtcgcaggacccgccgcgtcccgaaccgaggatcggcggcacg
ccaccgggattcgatccggcgggcaacggcaccgacccgggcggcaccggcaacgccgac
ggcggccacacgaacggcaccggcccggtgggaggtaatcagaacggcaccgacccggcg
ggaagcaccggcgcgggcgccgaccgcgccgggatcgcgccggagacgaccgcgccggga
accgccgcccccgaagcggggccggccggggaacccgccagccagacctcgcccgcggcg
ggcgcgacaccgcccgagaccggcgccgccgacccgaccacaccgcggggggaggggagc
accgcacccgccgacggcgagaccgcgccgggccgcgcggcggaccacgccccgccggac
gagggcggcgcaggcacccggggcgagtccgacggggagggccggaccgacgcggacggc
cgtcccgccgtggacgccgacaccgccggtgacggccggggcgagaccgacggggaagcg
acgcggagcggctccgacccgtcgacaccgggcgaccgcgccgcgacccccgaatcggca
gacggcggcgcccggaccgcagccctggaagcgagtccggccgcggcaccgtcggatacg
ggtgccgtgccgggcgccgatgccgcagccggcgcgcctcggcccgacgcagccttcgag
gcgagtccggccgcggcgccctcggatacgggcgccgatgccgcagcccctcggtccgac
gccgaggaggcgagtccggccgcgatccagtcggatacgggcgcgccgcgcggcgatacc
gccgccccgcgcgacgctgggcacccgtcgacctcggctcccgaaggaccgaccggcggc
agcgcggacggcaccgccgccccgcgcgtcctcgacgggaccgcgcccgcccggcccgac
agcgcaccgcagccgaccggtaccgcgttcggcttccccggcgccgccccgatctccggc
gcgacaccgccgccgggcgctctcccggccgccgcgccaccgagcgcggtcacacccggc
accggcgccgcaccggcgagttcgacacctggcaccaccccgggcaccggctcatccccg
gcgggatcgctcgcccagcacacccccggccagcacggcaccgaccggccgagcgccccc
ggggaatcccgccagacgcccggcccggcggcccgcccgtcggccgcaccggcggcccgc
gcgggcatcgccgacggcacctcgccgttcggccgcgagggcggtgtgcaggcccggcac
gccgacgcaccggcgccgctcgcggaacgctctgttgcacaagatgtttcctccgaggac
gccgaaagcgtccaggtaccgccggagggcatgctcgccgtcccgccgctggtcgccgac
ctcgccgcaccgcgcgcgggtcgcaccgacagcgccgaccgcccggcgtcgcgccccacc
ccggaggacagcgaccgcgtcgccggcgacgaccgggcgcgtccgtcgcgcgccggcacc
gacgcacccaccaccccgcgcgccgacgatccgaaccgggacgggggcacgtcgagcgac
ccggatcgcgtcggcgctccccaccacgattccgatccggcccggcgcggccggtgcgct
ccgctgtcgctgggcgagatcgccgacgcgaccggcagcacgtccatccgcgttcccgag
cacgtgggcccggaaggattgtcggccgccgagttggagcactacgcggggggccggttg
cacggcgtgcccaccccggccgacccagccgcaccgcgccaccaggccctcgccgacctg
ctgctgtcggaggacaacctcgccacgtgggcgctcgtggtcgacgaataccgcgggccg
gtcgacgaatacggtgtcggcgcgcacgcctacgtcctctcggtccaggtcgatccggcc
acgggcgcgcgctcggtggtggtgagcgaccccgccaccggcgtgcgccgtggcttcccc
ccggtcgtgccgccggagctcggccgtgtgcacgcgatcctgttcgacgcgggcggccac
gcgctgcccgaggacgccgcccatccgttggcggatctcatcggcgagggtggcgcgcgc
atcggccgctccgccgacgagcaccgcgaccagatccgcgaactgctcgcgctgaccccc
accggccgcgacatcctggccacgctggacagtgggccggtgcgcgacgcctacgagcgc
ggggccgaggacgggcgggtcggctcgttccggcgcggcgcgctggcggcggtcgcgttc
accgagggcaacagtcacctgcgccaggcgttggcgttggcgcacgagtcggtgcacgcc
cagcgcttcgtggacgggcagaccgcgcacacccgcgacggcatgcggtcgatgagccgc
gacgactacgtgcgggcgatgatcgaggaggaggccgcggccaccggcaggcggttccag
ttggcgcgggagctgcgcacgctgggcttcgacatccccaccaaccagttggaggcggtc
tacaccgacgcctacgagcgcgccgaactcggtctgtcgcgctcggagccggagctgccc
cccgccgaggtcgcccggatcgcccacgaggtggcggtcgacgcgctgcgcggcccgttg
gcgcactacgagttcgacaacggcgtcacctacacccgcttctacggcgaggcatgggac
cgggtgcggctaccaccggcccacggcgccgacgcgccgaacgcggacctggtgttccgg
cccaccgatgccggcgtcgtgcaggacctgcgccgcgccgtgctcgcgctgcgcgccgac
ctccttgcgctggaggacatctcgcaacggttgaccgcgctggccgcgaccgtcgatgtc
gacgcgaccgcgccgcggcaggtgttcgacgccaggatcgccgagcggctcgccgacctc
gccgcgggcgggcgggcgagggacagcgatccggcgcgggccgccgaactgcgccgggtc
gaacacgatctgcgcaccctgtcgggtctggccgaccagcgcgacgccgcccagcgggcg
gtggacgagcggtcccgtgacctcggtctgcgggccgcgcgcgagtacgtgcacgcgcgc
gccgagtcgaccccggacgcgcgggtgctgaccgaccagatcgtgctggtcccgggggaa
cccgaccgggtgctcgtcgccgcgccgcccggagaacatcccgctgttctcgacggcgcc
cgtaccgatccggagctggccgccctgctcgaccgcgcggaggtcgagccgttcgaggtg
cgggtcgacaacgacggccgcgtcttgctcgacgccgtcgatccgcgggcgatgcccggc
gccgacccgcgtccgagccccgaggggtcggccgatcggcccgaaggcgcggtggcaccg
cgggatccggcgggagcggcggccgatgcccgcatcgcccgggtgcgcgccgaactgggc
accaccgaggtcgggcggtgggccgacgacgtgctcgaccgcgccggggtgcaggtcgtc
tacggttccgacggcgcggaccgctacctgcccgcccgacgcaccctgcgtcttgacgtc
ggcgccaccgacgccgaacagatggtggcgctcgtgcacggcgccatccacgccgacacc
gcgcacgcccgggacacccccggtggtgcccgggagcggatgctgctgccgcgagccgag
tacgtcggccggatgctggacgaggagaccagggcgcacgcgctcgagatcgtggcccgc
ctgcaattgcgcgcggccgggcacgacctgccggtgacggacctggaacgggcctacacc
cgcgccttcgatgccgcccgcgcggccgccgtccgcgagcaccccgacgcgcccgcccac
gacctcgaccggcgcgccaacgaggcgggcctgcgggcactgcgtccgctggtggccgac
ctgcccgcggatccgaccggcatcacctacggcgaggcctacggcgcggattgggatcgg
tcacatggcatccgcccgttcgacgccctggtgcgcacggcgctggccgccggggaggtg
tcggcgcagatccggcacgagggcacctcggtcaacagcgcccgccgggtggagctggtc
accttcaccgacggcacccagctgatccgcaagaccatgatcaactcccggcacgccgac
gccgagcaactgttctcggccctggcgcgggcggtcggtgcgccggtgccagaggtgttc
cgcgccggacgcaacgtcgtctacctgcgcccggtgcccggggtgaccgcgcaccagcgc
tggccgggcttcctcgacccgcacgaactcggcgcgctggactccgacgcgggccgcgcg
ctcggcctggccgacgcgctggccggggtgcccgaccgcgatgcgagcggctggatggtc
gactcggacggcggcatccacggcatcggcaaccaccgtgccttcgagggcaccgtcacc
ccggcgacgctgagccccttcgcctcccatttcctgcgcgccaccgcggacggcgccctc
gaacctgtcgagcatccgctcaccgatcgtgagatggccgatctgcgcgagcgggtggcg
gcgctgcgcccggagttcgagcgactcggccgcccccgctggctcgacggtgcgctcgcg
actctcgacgcgctggccgagcacgcccgccccgccccgccgcccgaccccgggctgccg
gtcgacgcgggcgaggacgacctggtgtatgtcaaccggtacggcgggaccggccgccac
ggcatctccggtgtggtcgacgccgacggcgtgctgcactacgagatacgggcgggccgg
gccacgccctcgggccgggagatgttcgccgacatgatgcgcgaactcgggcacgcggtc
cgcgccatcgaggacgactggttcgccgagggtggcttcgacgaccagctggccaccttc
aacgcggcgatccaggacaccttcgccacccccgaggaagcggctttgtcgacgttcacc
ggacgtctggcggccgaactcgggttcacgcgagtcgaattcggccccgacggcctggaa
ggcccgctgggtgagaacaccgctgtcacggtgcgattcctgcgcccggaggaggcgttg
cccgcacccgaccttcgtccatccgagggcggccggaccgacaggccgctcggcatgccg
ccgttcacctcgcgcgacaccgacaacccgacacgcccggtcgaccgcgaccgcggcacc
gacgccgtcgacccgccggagttccccgccgagcgcggagccggcgatgccgatgccgac
cgggccgccgccgcgcagcagcggcgcgcggagctggaccgcctggccgccgaccgcgac
gccgccgtgcgggaccgcgagcacgcgctggccgccggggaccgcgagcgggccgaagcc
gcccgggagcggatcgaccggttgggcgagcagatcggcgccgcgatcgaacgggacgcg
ctcgccggggtcgatgcgcggccgctcaccgaccgggtcggtgtcatcgatggcgcgcgg
ccggtcgtcgtggtcgccaaccgcgggggcgcggacgtacgggcgctgctcgccgaagcg
gccgggcggcaccccgagctcgcgcggctgctcgccgatcccgaggtgacggtgcgggaa
ctgcggatcgacgagtccggccgcgtcgccgtcgtgcgagtcgagaaccccgggccggta
gggcgttccgacgaccccggggcaccgtccgccccggccgagacgccaccgctcgccgcg
gacggcggtgcgggcaagccgccctccgaaccgccggtgtccgccgggccggaccccggc
gagcccgatcccggcgccggatcgacccggcgcgactggaccgcggacggcccggcgcgg
acgcaccagccgaccaccgaccgggcccggcgggacctggccggggcgggggagcggatc
gccgatgccgtcgcgacccgccggatggccgaggaacgcctcgccgacctcgcgcggcag
gcggggatcgacccggacgggcgcacgccccaccagctgtcgcgactcgccgacgacctg
ctcgccgcggccgaagcacgcgtcgacgccttgcacggccggaccgcggtgccgcgcgag
gagatcgtccggtacttcgacgagttgcgggcggcgcaggcggagctgggccggaccgtg
cgcgcggtcggtgcgttgcgcgcggaggtcggccgctggacggccgcggcacgggccgag
gacgaggccaggacgacggcgggtgtgctggccgcccgcgatgtactgaccgccgagggc
acgcggatgatcagcgaaggcgtcggcctcgcgccggacgggcaacgcgtcgtggtcgcc
tcgccgctgacccggccggacgccgtgatgcccgccgaggtgcggcgcatgctcgccgac
cgcggtgtcgccgtggactatcggctcgtggcggtggacgcggcgggccgggtcaccgtg
accgacctgcgcccgcccgcggcggaggcggaaccggccaccggaccggagagtgctcga
ccggaccccgcccggtccgccgccgaaccccggccgcgcgtgcggcagccggacacttcg
gcggagcagccggtccgtccgcgacctgccggaccggataccgatgtcacccccgagccg
accgcgccgcctgctcgaccggacggcggccccgacgactacggcgcgctgctgcgcgac
cgggcggccctggcgtccgagcgtgagttctggcgggcgaagcgggacgatcgggcggat
cggttgggtctggccgatcctgatcgggagctgggtccggaccggctggagccgacgttg
cagcgtttgctcggtgaggtggtcggtactcgggaaaccgccgggaccggtgaggagttg
ccggggcggacaccggagctggttgggtcggcggagctgtcgcaacggcgcgagcggatc
ttccgtctccaggacgcggcggaacggttcatcgccgcttccgacgcgctggccgaggtc
gaccgccggatcgccgcgctggaggcggcgggcgcgggtgcgggcagacaccccaccgcc
gaggtcgccgccgagctcgaccggctcggccgcgaacgcgccggacaggtgctggcgctc
aagccctggcgggtcatgcgtgacgacatcgcggcccggctgcgagtcgatccggaccgg
ttgggtccggaggatctgccggccacgctcgacgaagtggcgaaccgtcgggtgcgcgcg
gacgagatcgagttgcggatgcgcaacctgcggttgctggccgaagccgccgaacaggtg
aatcggcgggagaacgagatcggccgagtgcaggaccggataaccgagctcgccgggtcg
gcgcgggcgttgttcgacgccgccggcgctcgtccgatcaccgatcgggtcgggttggtg
gacgggccgaatccgcggatcgtggtcgtcggtccgcgcgggcggtgggatgcgccgttc
gccgatcacgacgcggcgttggcggaggcgctgcgccggagcggtgccgtggcgcaggcg
atggtgcggccggagaccacgatcgagtaccggcagatcgtcgccgaccgggacggcacc
tggcagcccgtcgatctcgccccgccgcggcgggagttcatcgatgcaccgcccagcaac
ggcaggcccggcatccacctgacccgctggcgcgacggcgacggcgaatggcaccacgtc
gacaccgcgcgtccggactggagtgccggccgggacgagagcggggtgccgaagaagttc
gagccgcgtgacctgcctgagggggtgagcgggtgggcggtgaatccgttccaggccgcc
gtggtcgacccgttcgtcgatccctccggcggcacacccgcgggcgcgatcaacgaatcg
ttcctgccgacgatcccgggtggcatgccgcccggcgacatccccagctactcgctgccg
ttcgcggacgcgttctatcacacgatgcggatcattctggagtccgcgaagttgtcgggc
ttcacctggtacagcgacagcgaacatcccgggcggattcgtcccggcttcaagggacat
ccgtggttccgcgcccctcgcgcggacgtgcagccgatggtgcgggagtggaatgccgcc
gaccgcatccccgacgacggcaacctcacccgccccttcctcgaccgccaggaggcggcg
cggcagcgctgggcgcgggtgcaggcctgggccgacgagcagtaccggaccttccgcgcc
gacgacagcgacatcacccgcatcgccgacaacctcgccgaccgggccgccgccgaccgg
atcgcgcacgcgcgggaactgatcgaccgcgtgcgcgcggtactgcgcggcgacgcggag
gtggacgcgctggtcgacgacctcacgggcgcgctggccgacgaacgacccggtgacgcc
gcccgcctggtggccgacctgctcgacgtggtgggcaggccgatggaccccgccgaccac
gccgaggtcacccgactggtggccgaccagctggccgaccgcgggccgaccttcaccgcc
gaggacatcgagcggatcaagaaccacctgatgcgcgacgagcacctgatccgtgatccg
cacgacggcaccctcgtccgcaggccgctcgatgccgtcgccgacgtcgccgaagcctgg
catcgcctcctcgcgggcgagccactgccgcaggacatcctgctgctccaggacgcccgt
gccgagtcggatttcctgcgcgacaacccgatcgccacctggcgcgacgccaaccagcac
gcgatcagcctcggctacgactggaacgccgaccggccaccgctcaccgactggcgcgcg
aacatcccttacgcacccgcaccggtcggcccacaagccccacccgccgccggacctccg
gcgagcaggccggagtcgtcggaggaacagcccggccgcccgcccgccacgccggcgccg
gccacgccggagcccccggacgattcggcttcgccaccccatcccgaggccgaggcgacg
cgtcccgaacttccgccggcgccgcccgagcttcccacctcgcgggccgaacctcagccg
acacggggcgaacgcccgccgacgcaaccggctctgaccccaccggttccggccgagagc
gcaggcgtctccgagacccgtccggataccgcgctgcccgcggccgtctccgacccggtc
gagggcatgccatcggcggacgacggacgggcgagcgccgcacccgcgcggtcgcggtcg
gtggttccggaggaaaccggctcgcccacaacggaatccaatggcggtgcggggcgcccg
ccgtccgatccgccgacccggggcgcccccgatcccgacgagccctcggagtggttgcgg
gcgcggttggccgagcaggaggagtggaacgcgcggatgcgcgcggagctggccgagtgg
gcggcgcggatgcgcgacggtgcggtggcgcgcgagttcgaaggcctccagcgcgagatc
gacgacgccttcgccgcgatcgatcggcggctggccgaacaccgggcggccgagcagcgc
cgcaccgaggagttcttcgccgacctcgcgcgccgcgccgggctcccgtggtccaccgag
gaacccgcgacgcggcccgatgcggaacctccgcccgccggtgccgacgccggtcgtccg
ccggacgacgacgcggtgccgaaccggacggatccggccgacgattcccggccacccgtg
ccgacgccggacgagccctcggagtggttgcgggcgcggttggccgagcaggaggagtgg
aatgcgcggatgcgcgcggagctggccgagtgggcggcgcgaatgcgcgacggtgcggtg
gcacgcgagttcgacggcatccagcgcgagatcgatgccgcgttcgacgacatcgagcgg
cgcctcgccgagcagcgcgccgacgaacgccgccgcaacgacgagttcttcgacgaacta
ctccgccgagtcgctctgccctgggcgccggccgaccccgccaccgagggacaggtcgat
ccccgccgcggctccgaggacgatcccgacaaccgcgcggaaacgcccaccggcggcgag
catcacacccgggacgacggcgcgcaccaccccgagcgcggcggccgtcgcgacgatccc
accgacccggaggacgggaccgatggtgccgcgggccatcccgcggacccgccctctcgt
ccccccgccgccccgtccgccgccgctccggagtcggtcccagaccaggtggcgccggta
ccggaggacgaacggtccacgggcgaactggcggcgggtgacagcgccgagcgggacggt
cccgccgcatggtcgccggtcgggcccggacaggaggtcgcgccaccgtcggaggcggtg
gcgcgggagttgcgcgcactgggtgaacgggccgccgcggcggccgcacgccgcgcggat
atcgaacggcagctactgcggcaggtgggtgagctgccgatcgatcgcgcggatctgtcg
gtcgaggaggtcgtgcgcgccgccgaagagcatctgcgggaggcccgcgcccgcgaggac
gagctgcgcgacgggtgggatgtggcgctggacgaggtcgacgggcatcagcgtgcggtg
gccgaggcggcccatctggccgaccgggcgggccgggtggtcgaggcgatccgtgcggca
atacgagagcgtgccgaggcgatccgcgccgaacacgacgcgcggatgaccgcgggtgtc
ctggccgcgcgtgcggtcctggacgccgagggtgtgcggatgatcggtgagggcgtcgga
ctgtcgccggacggccgccgggtcctgatcgcctcgccgctcgcggaccccggtgtgctg
ttgccgccggaaaccagggcgctgctggcccgcaacaacgtcgagatcgactaccggctg
gtggaggtcgacggggccggccggatcaccgccacccccatcgccccgccccgcacgccg
gaaacctggagtacgccggaatccaccgccgaggcaccgccgagccgggagccggacgag
catcgcagccggctgcgggagcaactcgacggtctgcgcgagcggcgcgccgaggcggcg
gaccgggccgagcggctgcgcgacgagatcgccgacctcgcccggagcaccgccgacgac
ccgaccaccgacgccgcaaccaccgaggccgacgtcgtcgcccggcgggtgcgcgatctg
gccgaggccgaagccgaggtcgcccgtctcgacgagatgctggactacctgcggacggcc
gccaccccggacacggaccacgaagccctgctgcgggaacaggcccgactgacctccgag
cgtgagttctggcgggcgaagcgggacgatcgggcggatcggttgggtctggccgatcct
gatcgggagctgggtccggaccggctggagccgacgttgcagcgtttgctcggtgaggtg
gtcggtactcgggaaaccgcggggaccggtgaggagttgccggggcggacaccggagctg
gtgggttcggcggagctgtcgcaacggcgcgagcggatcttccgtctccaggacgcggcg
gaacggttcatcgccgcttccgacgcgctggccgaggtcgaccgccggatcgccgcgctc
gaagcggcacgtggtctgccggatcgctcgcgcgccgccgaggtcgctgcccagctggaa
caactcggccgggagcgcgccgggcaagtgctggcgctcaagccgtggcgggtgatgcgt
gacgacatcgcagcccggctgcgggtcgatccggaccggttgggtccggaggatctgacg
gccacgctcgacgaagtggccggtcgccaggtccgtgccgacgaactcgaactgcgcgcc
cgcaacctggaattgctggccgaagccgccgatcaggtgaatcgccgggagaacgagatc
ggccggttgcaggaccggatggcggaattggcgggagccgatcgcgagatcttcgatacc
gccggtgcgcgcggcatcaccgaccgggtggggttggtggacggaccgaatccgcggatc
gtggtggtgggtccgcgcggccgatgggatgccccgttcgccgatcacgacgcggcgctg
gcggacgcgctgcggcacagtgccgcggtggcgcaggcgatggtgcggccggagaccacg
atcgagtaccggcagatcgtcgccgaccgggacggcacctggcagccggtggatctgccg
tccccgcgccgtgaattcgtcgacgcgccaccgcgtaacggaggaccgggtattcacctg
acccgctggcgcgacggcgccggcgaatggcacgaggtgaacacctcgcggccggactgg
agtaccggccgggacgagagcggggtgccgaagaagttcgagccgcgtgacctgcccgag
ggggtgagcgggtgggcggtgaatccgttccaggccgccgtggtcgacccgttcgtcgac
ccctccggcggcacgcccgcgggcgcggtgaacgaatcgttcctgccgacgatcccgggt
ggcatgccgcccggcgacgtgccgagctactcgctgccgttcgccgacgtcttctatcac
acgatgcggatcatcttggagtccgcgaagttgtcgggcttcacctggtacagcgacagc
gcgaatccgggccggattcggccggggttcaaggggcatccgtggttccgcgcgccgcgg
ccggacgtgcagccgatggtgcgggagtggaatgccgccgaccgcatccccgacgacggc
aacctcggccccgagtaccgcgcccggcagcaagcggcacgcgagcaatgggcgcgggtg
caggcctgggccgacgagcagtaccggatcttccgcgacatgggtgccgacgatctcgcg
gccatcttcgacaacctcaccgaggccgcccgggccgaccgcgccgcccgggcacaggat
ctgatccagcgcctgcgcgaactggcggcccaggacgaccccgatgtcgaggcggtcatc
gccgaactcaccgggacgttgcccgacgaacaacccggcgacgcggcacggctggtcacc
gacctgttggcggtggtcggcaggccggccgacgcactgcgccccgacgaactggtcgaa
ctcgtcgctcagcagctgggcgccgacgaaccggagttcacctgggaggaactccagcgg
atcaagaaccatctgatgcacgacgagcatctgatccgcgaccccgaggacggcaccctc
gtgcgccgccgcctcgacgccgtcgccgacgtagccgaggcctggcaccgcctcatgaac
ggcgaccacctaccccaggacctgctgttgctgcgcgacgcccgcgccgagtcggatttc
ctgcgcgacaacccgatcgccacctggcgcgacgccaaccagcacgcgatcagcctcggc
tacgactggaacgccgaccggccaccgctcaccgactggcgcgcgaacatcccctacgca
cccgcaccggtcggcccacaagccccacccacccgcccgaccccgcccccaatcccgccc
agcaccccgggcaatgccgcgtcacccggacccggcgcggaccaccgcacccgcccagcc
gacacggctccgcaccgaccatcggaggcggcgaccacccctgccgacgacccggccgca
ctgtcgcccgagatcaccggcgacggcggcgagtccggcccacggccagcacggccggac
gggaccatccgtgccgacgaccgggccgccttgtcaccggagggcatagccgacgatggc
gagtccggcccgcagccagcgcggccggacgggaccaccgacgatcgggccgccccgtcg
cccgaggtcaccggtgaatacggcgagaccagcccagcgcggccggacgggaccatccgc
accgaggaacctccccccgacgaggacgagggcgacgacccaccggccgccgcgccgccc
gcggggccgccgtcgcaaccccccgccgccccgccggccgccggtgacccgggagacccc
ggtgacgagggcgatgcgcaccgcgcgcgggagtccgcgaccgccgcggagtccacggac
tcggcgtcccgggacgcgccgccggaagccaggggtgccgatgcctcgtcggagtccacg
gatcgtgtcgacacgtccgagaccacaccggtcgatcccgcgccggagccccggcctgcc
gcgccgacgcgaccggccgccgacccgactgcaccgcccgcggccgacacgcaatcgcag
cggcgcgacgcggtgccgaaccggctcgccgccgacatcgaagcggccgtccgggaacgg
gacgccgcccggaccgcgggcgacgatcgggccgtcgaggcgacgaccgagcggatcgag
cggctcgcgggcgccctgctgtcggccaacgcccagcacgcgctacgggcagcgggcgcg
cacctggtcggctcgcgcgtgggtgtgctcggcggtgaaccgccgcggtatctcgtcgcc
ggatggggtggtgcggacaccggcgccgcgctcgccgatgccctggccgccgacccggcg
ctggccgaattgctccggctgcccggcgtcgagatccgcgaactgcgcctcaccatcgac
gagaacggcgccatcggcgctcacctcgtcgacccgcccgcgtccgcagccgatcgcggt
gatcagacggcggatcgcgacacggtcggccaaccacccgccaccgcaccggaatcggac
gcgccacaacgcgaccacacccgcgtcggagccggggaacccgcgaaccccggggacgat
ccagcacgtgacagcgccgacgatcccggcacgcgcgactccgcccaggccgaggcccgc
cgggcgcacgcggaagccctcgcccgccgcgacgagctggcggcccggatccgggagctg
ggggagcggttgccgatccgcgagccggaagcactcgacccggaccacatcgcggccacc
gtgcgggaactgtccacctggaacctgtccgagccggaccaggtcgccgcactggcggag
ctggtcgatctggtgccgggcttcctcgaggcccacgccgatgccgccctgctggccgcc
cgcatcggcctgctcgacgactacgaccggttgctcgccgagcacaaggagctggtgcgg
gagcgcgagttcgtccgtgccaaggccgacgagcgcgccgaacacctgctcggcaccgac
gatccgccgtggaccacgcgcgactcggacagccgcgacgacgccatccgcgcccgctac
gccgaggcgcgcaccgatctgatcgacatccccgccgggcccgacgaggtcggtcaccag
gagcgcaggctcgccgacccggacgacgtgcgcgaacgccgtcgcgcgctggagaaactg
atcgagaccaccggtcgcttcgacgatctcgccgaacaggtcaggcaggtggaacagcga
ctggccgacctggagaacgccggcatcgcgcaataccgcccgcccaccgccgaggtcgcc
gaccgcctcgacacgctggcgcgcgagcgtgccgccgaactacgccgcatcaaaccgcgc
cgcgccatgcgcgacgatctggcgctgcgcctgggcgtcgtcgacgacaccggtgcaccc
gacgagcccgcgctgagccgcgatctcgaccgcacgctcgccgacctgcgcgcgcgggtg
gccgccgacctgcgctccggcgccctgccggtgaacgaactgcccgcgcggttgcgtgcg
atcgccgcgctcgccgacgccgcacccgaggtggcacgggcgcacaaccggatcggccgg
ttgcaggacgagatggccggactggcgggtgcgtggcgcacgcagatcgaggccgagggc
ggacggatggtcaccgaccgggtcggcatcgtcgagggcgagcggccgcgcatcgtcgtg
ttcggcccgcgtcccgacccggaatccccacgggccgaacacgatcgggccttcgaggcc
gcgctgcgcaccgccgcgccggtggcgcaggccgtcgtgcgccccgagacgaccgtcgaa
taccggcgggtgctcgccgaccgccaaggcgaggtgcggtcggagacgatgccaccgccg
gaggtggagcggttgtccgcgggcggtgtcggcggccgtcgcctggacatgacccagtgg
cgcgacgccgagggcacctggcatccggtggatcccacccggccggactggacgaccgga
cgcgacagcggcacgctgccgaagaagttcacgcccaaggacccgcccgacggcgtcagc
ggctgggcgatggaagacgtggtcaacgacatcacgctgcccaccgacgacgtgccgccc
ggacagatcccggagagcacgctgcccgtcaacgccccgatggcgccctcgcagtacagc
accgggggcgtgcccgacggcgcgacggtgttcggccagcactggggcgccgactcctac
aacgtggtgcgcctgatcctgatggccgcgcaggtgcccaaacaccccgcggtgcaggcg
tggttccagcggcatccggagatcggccgctgggtgcaggccaggccgtggttgcggcac
atcccacccttcggcaccgtgttccgcgactaccagtggttcgcgccgccggaacgcaac
gtgcagccgatgttccgggcctgggacgtcgccgaccacgccccgcccgcggagcgggtg
gacattccggacggactgcgcgcggagtgggaccgcgaggtcgccgactggcaacgcgtg
caggactgggccgactccgagtacgagcggttcctcgccgacgactccgacatcgacgcc
atcgtcgagggcctggacgcgcatcggcgggaccggcagcgggagctggcccgcgaagtg
gtcgacgccgtgcgcgccgaactggtcgaccgccaccgcggtatcgacccggtcggcgac
atcgacgcgcaactggccatggtggccgccgacatcgatcgggtcgccgccgacctggcc
gaccgcttcgccgccgccgacccaccggccgtgcggtccacggtcgaggacatcagggag
ctcctgctcgccccggaccagcccgcgagtttcgcggccgagctgcgccccggcgagacc
cccgaggacgcgatcgcccgcctgctcgccgagcacatgcgcgacgacgtgccggtgttc
acccgcgagcagatccagcagatcaaggaccacctgatgcgcgacgagcatcgggtgcgc
gaccacaccgaccccggcggcggctacgtgcgccgcccgatggaccgcctggccgacgtg
gccgaggcgtggcaccgcctgagcacgggcaggccgctgccgcaggatttcgtgctcctg
cgcgacgccctcgccgaatcggagttcctgcgccgtcatcccaccgcgggctggcgcgag
gccaacacccacgccgtcggcctcggccaccactgggacgccgaccgccccccgctcacc
gactggcgagcaggcatcccctacgcccccgcacccctgcccgtcgacccgggctggact
ccgccgggtgaacgcggcaccgccctgcccgcccccgacggacccgaaaccgggccgccc
ggcgggcgctccgcccagctcccacccggcgagaccgcccggcccggcgatcccgcgacc
gacggcgccccaccacatccgggcgaccgccgggtgtggccgccggagccgcccacgcca
cgtgattccgccgacaccgaggccgacgagtccacgactcaatcgaggtcgcccgggccc
cccgctgattcccaacacagcgacccgatcaccgaagccgatgcgccgcaccggccggcg
gagacgccgtcccccgagtcgacgaccggcagcgggcagttctccgccgaccaggggcac
cggcaggcgcgggaccgggtcgaagccgcccggccggtcggtggccgcgagcccggcgag
gtgccggattccgccgagggacctcaggtgccggacggcggggagccgggcgacgcatcg
gcgacggagggctcggcggtaccgcggaccgggtccaccctcggtgccgagtccgagtcc
gagtccgagtccgagtccgagtccgagtccgagtccgagtccgagtccgagcccggcgtg
cggcacgacggtgatgatccggacggtgctgctggtcggcggtcgacggggccggacgct
gaggagggtgctgtccggtcggagggcgacatgcggaccgacggtgatcgccgctcggac
ggtgccccctcggacggtgctgcccggaccgacggtgacgcccgatcggacggtgacgtc
cgcccggacggtgacgcagggacggacagtgacgcagggacggacggtgacgcagggacg
gacagtgacgcccgtccggacggtgacgcacggacggagggaaacgcgcggacggaggtt
gacgcgcggacggagggtgacgcgcggacggacggtggcgcgcggacggtgggtgacgcg
cggacggaggggaacgcaccgccggagggggatgcccgcccggacggtgacgcacggacg
gacggtcaaacccgctcggagggtgacgccgaccagggcgaccgtgctcgaggcgccgat
ggggggccgcatgaaccgggcgccggggagggccccgcggcgtcccgtccaccgcggctg
ccggggtcgtccatgcggtcgcacatcccgcacccgcccaaggaccacgacatcgagttg
ccgccgaccgggaccatcccgccgcgggaccccggaccgtggccgttgcccgacccgccc
accgagcccggtccgggcgatccgccgcacgacccgccgcacgatccgccgggttccgat
tgcccgccgaccccgcccgccacggactgcccgctgccgcccgctgcggactgcccgccg
cccgccacggactgcccgccgccacccggcgcggacagtccaccagcgcagtccacgccg
gtgccccctgccgcgccgacacccgacccgtcgtgcccgccggcccccgccgagccggac
ccgccctgcccacccgacggcacccgaccgccgggccagcagctcccacccggcacctgc
ccgtctggtgggtggtcgccgggtgaggtgccgtctggtgggtggtcgccgggtgaggtg
ccgtctggtgggtggtcgccgggtgaggtgccgtctggtgggtggtcgccgggtgaggtg
ccgtctggtgggtggtcgccgggtgaggtgccgtctggtgggtggtcgccgggtgaggtg
ccgtctggtgggtggtcgccgggtgaggtgccgtctggtgggtggtcgccgggtgaggtg
ccgtctggtgggtggtcgccgggtgaggtgccgtctggtgggtggtcgccgggtgaggtg
ccgtctggtgggtggtcgccgggtgaggtgccgtctggtgggtggtcgccgggtgaggtg
ccgtctggtgggtggtcgccgggtgaggtgccgcccggtggatggttccccggcgaggtt
cctcccgatggttggttccccggtgcgatcccgcccggtgaccggccgtcgcatcccggc
ccggcgggaccgggcgacgtgcccggtccgggctcgcaaccgcccgcgaacggttggcag
ccgccgcacgcaccgcagccgaacggcgccccgcccggtacaccgcacacgccgaacact
cccggccggtggaacccaccggattcctggctgccgccgggcgcgggaccgaacggtccg
acgtccggcgccacccccggcaccggcgcccccacccagggcggcgaacggccggaccgg
tggccggcgaacggctccggcggccggccgcacggtacgccgacgcccccaccggtccag
gaccagagccaacccgcgacggcggcgccgatgatgccgcccggtgtcccgggcatgccg
ggggcgagcgcgcaccccgcgggcgctgctcggcgtcgtggcgccgacggctaccgtccc
cccgatgccgccgaacccaccacgctgttggtccgcccgcattcgggtttcggcgtctcg
gccgagttcgacccggagaccggcgcactccaggccacgtcgctgcgcacgggtgtggag
tccggtgtgtacggcgagctcgccggcgtgccggtggtgctgtaccgccacgactcccgg
ttgcgggcgcgggtcgggcagcagagcatcgatctggacggcccggtgacggtgaactgg
gtcgcgggcgcccagcggcagaccacgttcaccatcagcgcgggggagacggtgctgtgc
acgctgacctaccggacggtgcccgccgaactcgacatcggccggttcatccgcgaggtc
tgggccgatccggaccggcgcgcgcggatgttcgcctga

DBGET integrated database retrieval system