KEGG   Nocardia farcinica IFM 10152: NFA_8790Help
Entry
NFA_8790          CDS       T00207                                 

Gene name
alr
Definition
(GenBank) putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00473  D-Alanine metabolism
nfa01100  Metabolic pathways
nfa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nfa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NFA_8790 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NFA_8790 (alr)
Enzymes [BR:nfa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NFA_8790 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:nfa01011]
 Precursor biosynthesis
  Racemase
   NFA_8790 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAD55724
NIH_Japan: nfa8790
UniProt: Q5Z1G7
LinkDB All DBs
Position
980992..982137
Genome map
AA seq 381 aa AA seqDB search
MAGSGDVSAQVEAVVDLDAIAHNVRVLREYAGDAAMMVVVKADGYNHGAVEVARTALAAG
ARELGVTTVAEALRLREAGITAPVLCWLNTLSADYAAAVAADIEIGVSGTEQLRAVATAA
RATGRTATVTLKVDTGLNRNGIAADELPTVLDLLGELVEEKTVRLRAMFSHLAHADEPKH
PFLDEQRDRFTAAAAAATARGLRPELLHLANSAATVTRPDLAFDMVRPGIAVYGLSPVPE
LGDFGLRPAMTFQAQVALVKRVAEGEGVSYGHQWIAPRDTTVALIPAGYADGVFRPLSGR
FDVWLGGTRRPNVGRVCMDQFVVDLGDDAAGVAAGDTAVLFGGGPGVPGAQEWADLLGTI
HYEVVCSPRGRAVRRYVGTGR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggatcgggagacgtgagtgcccaagtggaggccgtggtcgacctcgatgcgatt
gcccataatgtgcgggtcctgcgtgagtacgcgggcgatgcggcgatgatggtcgtcgtc
aaggcggacggctacaaccacggggcggtggaggtggcgcgcacggcgctggcggcgggg
gcgcgggaactgggcgtgaccaccgtggccgaggcgctgcgactgcgcgaggcggggatc
acggcaccggtgctgtgctggctgaacaccctgtccgccgattacgccgccgcggtcgcc
gccgacatcgagatcggcgtctccggcaccgagcaactgcgcgccgtcgccaccgcggcc
cgcgccaccggccgcaccgccaccgtgacgctcaaagtcgacaccggactcaaccgcaac
ggcatcgccgccgacgagctgccgaccgtgctcgacctgctcggtgagctggtcgaggag
aagacggtgcgattgcgcgcgatgttctcccacctggcccacgccgacgagcccaaacac
ccgttcctcgacgaacagcgcgaccgcttcaccgccgcggccgccgcggccaccgcccgc
gggctgcgtcccgaactgctgcacctggccaactccgccgccaccgtgacccggcccgac
ctggccttcgacatggtgcggcccggcatcgccgtctacggcctgagccccgtgcccgaa
ctcggcgatttcgggctgcggcccgccatgaccttccaggcgcaggtcgcgctggtcaaa
cgcgtcgccgagggcgagggcgtctcctacggccaccagtggatcgctccccgtgacacc
accgtcgcgctgatacccgccgggtatgccgacggcgtgttccggccgctcagcggccgc
ttcgacgtgtggctcggcggtacccgccgccccaacgtcggccgggtctgcatggaccag
ttcgtcgtcgacctcggcgacgacgccgcgggcgtggcggcgggcgacaccgccgtgctg
ttcggcggtgggcccggcgtgccgggtgcccaggagtgggccgacctgctcggcaccatc
cactacgaggtggtctgctcgccgcgcggccgggccgtccgccggtacgtcggaacgggc
cgctga

DBGET integrated database retrieval system