KEGG   Nocardia farcinica IFM 10152: NFA_9230Help
Entry
NFA_9230          CDS       T00207                                 

Definition
(GenBank) putative isocitrate/isopropylmalate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nfa  Nocardia farcinica IFM 10152
Pathway
nfa00020  Citrate cycle (TCA cycle)
nfa00480  Glutathione metabolism
nfa01100  Metabolic pathways
nfa01110  Biosynthesis of secondary metabolites
nfa01120  Microbial metabolism in diverse environments
nfa01130  Biosynthesis of antibiotics
nfa01200  Carbon metabolism
nfa01210  2-Oxocarboxylic acid metabolism
nfa01230  Biosynthesis of amino acids
Module
nfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nfa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NFA_9230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NFA_9230
Enzymes [BR:nfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NFA_9230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAD55768
NIH_Japan: nfa9230
UniProt: Q5Z1C3
LinkDB All DBs
Position
1024847..1026064
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDKTDDQVTVDA
AEAIKRHGVGVKCATITPDEARVKEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNIPRL
VPGWTKPIIIGRHAFGDQYRATDFKVFQGGTVTLTFTPDDGSEPIVHEVVKMPEDGGVVM
GMYNFKKSIEDFARASFNYGLQQNYPVYMSTKNTILKAYDGMFKDTFQEIFDTEFKSQFD
AAGLTYEHRLIDDMVASSMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIGFAQTLE
DVVIKTVEGGQMTKDLALLVGGDQGYLTTEEFLGALDTNLARALR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaaggcaccgtcgtcgaactcgatggtgatgagatgaccagg
atcatctggcagttcatcaaggacaagctgatccacccgtacctcgacgtgaacctcgag
tactacgacctgggcatcgaataccgcgacaagacagacgaccaggtcaccgtcgacgcg
gccgaggcgatcaagcgccacggcgtcggtgtgaagtgcgccaccatcaccccggacgag
gcgcgcgtcaaggaattcggcctgaagaagatgtggcgctcgcccaacggcaccatccgc
aacatcctcggcggcacgatcttccgcgccccgatcatcatctccaacatcccgcgcctg
gtgccgggttggaccaagccgatcatcatcggccgccacgccttcggcgaccagtaccgc
gccaccgacttcaaggtgttccagggcggcaccgtgaccctcaccttcacccccgacgac
ggcagcgagccgatcgtgcacgaggtcgtgaagatgcccgaggacggcggcgtcgtgatg
ggcatgtacaacttcaagaagtccatcgaggatttcgcgcgggcctcgttcaactacggc
ctgcagcagaactacccggtgtacatgtcgacgaagaacaccatcctgaaggcctacgac
ggcatgttcaaggacaccttccaggagatcttcgacaccgagttcaagagccagttcgac
gccgcgggcctgacctacgagcaccgcctcatcgacgacatggtggcctcctcgatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacacc
gtcgcgcagggcttcggttcgctgggcctgatgacctcggtgctgctgaccccggacggc
aagacctgtgaggccgaggccgcgcacggcaccgtcacccggcactaccgccagcaccag
cagggcaagccgacctcgaccaacccgatcgcgtcgatcttcgcctggacccgtggcctc
gagcaccgcggcaagctggacaacacccccgaggtgatcggtttcgcgcagacccttgag
gacgtcgtcatcaagaccgtcgagggcggccagatgaccaaggacctcgcgctgctcgtc
ggcggcgaccagggctacctgaccaccgaggagttcctcggcgcgctcgacaccaacctg
gcccgcgcgctgcgctga

DBGET integrated database retrieval system