Nocardiopsis flavescens: HUT17_05470 Help Entry HUT17_05470       CDS       T06721                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism nfe  Nocardiopsis flavescens Pathway nfe03060   Protein export nfe03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:nfe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     HUT17_05470  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     HUT17_05470  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:nfe02044]     HUT17_05470 Secretion system [BR:nfe02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    HUT17_05470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QKW32585 LinkDB All DBs Position unnamed2:13752..13931 Genome browser AA seq 59 aa AA seqDB search MDPDKRMNPATLRSELGETVQGFRDWANGPDRTEEPTPAPDAPKGFTPGRTIPLKTPMH NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atggacccggacaagcgcatgaacccggcaacgctccgtagcgagctgggggagaccgtg cagggcttcagggactgggccaacggcccggaccggaccgaggagccgacgcccgccccg gacgccccgaaggggttcacgccggggaggacgatcccgctcaagaccccgatgcactga

DBGET integrated database retrieval system