KEGG   Aspergillus fischeri: NFIA_017670Help
Entry
NFIA_017670       CDS       T01070                                 

Definition
(RefSeq) glutathione S-transferase, putative
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NFIA_017670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nfi02000]
    NFIA_017670
Enzymes [BR:nfi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NFIA_017670
Transporters [BR:nfi02000]
 Other Transporters
  Pores ion channels [TC:1]
   NFIA_017670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 GST_C GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 4591516
NCBI-ProteinID: XP_001264963
UniProt: A1D3S3
LinkDB All DBs
AA seq 287 aa AA seqDB search
MPSVPDAELYPEASGPAKALVDRHQAEQPLKLYAGWFCPFVQRVWLALEEKQIPYQYIEV
NPYHKPQSLLSLNPRGLVPTLACPTGQSDGNGLKLKPLYESNIILEYLEEAYPDHQPRLL
PGDPYEKACAKVWMDFVTTRVIPAFHRFLQYQPQSKDEDVATETDKVRQEFLACLKEWTK
EMHPEGPFFLGDQISMPDLVLGPWAVRLWVFDEFKIGGLGIPAEGQGGEDEPVWQRWRTW
LRAVEDRRSIRDTTSEKDHYLPIYQRYADNTAQSELAKATRAGRGVP
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccttccgttccggacgccgagctctaccccgaagccagcggaccagcaaaagcgctg
gtcgacaggcatcaggcggagcagcctttgaagctctatgcgggctggttttgtccgttc
gtccaacgtgtctggcttgctctggaagagaagcagatcccataccaatacatcgaggtc
aatccctatcacaagccacaatcacttctgtcgctgaacccgcgcgggttagtccccacg
ctcgcttgtcctacgggacagagcgacggaaatggcctcaagctcaagccactctacgag
tcgaacatcatcctagagtacctcgaagaagcttatcccgatcatcagccgcgtctactt
cctggagacccctacgaaaaagcctgcgcgaaagtctggatggattttgtaacgacccgg
gtgattcccgcgttccatcgcttcctgcagtaccagcctcagtccaaggacgaggacgtg
gctactgagactgacaaggtccgccaggagtttctggcttgtctgaaggagtggaccaag
gagatgcatcccgaggggccatttttcttaggggatcagatttcaatgcctgaccttgtg
ctgggcccttgggccgtgcgcctgtgggtgtttgatgagttcaagataggcggacttggg
attcctgctgagggtcaggggggagaggatgagcctgtctggcagcggtggaggacatgg
ctccgtgctgtagaagacagacggagtataagggacacaactagtgagaaggaccattac
cttcccatctatcagcgctatgcggacaatactgcccagagtgagctggcaaaggctaca
agagctggaagaggggtgccatga

DBGET integrated database retrieval system