KEGG   Aspergillus fischeri: NFIA_032960Help
Entry
NFIA_032960       CDS       T01070                                 

Definition
(RefSeq) Glycosyl hydrolase, family 15, putative
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_032960
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     NFIA_032960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 AMPK1_CBM
Motif
Other DBs
NCBI-GeneID: 4593195
NCBI-ProteinID: XP_001265627
UniProt: A1CYB0
LinkDB All DBs
AA seq 627 aa AA seqDB search
MPRLSYALCALSLGHAAIAAPQLSPRATGSLDSWLATESTVSLNGILANIGADGAYAKSA
KPGIIIASPSTSDPDYYYTWTRDAALVTKVLVDLFRNGNLGLQKVITEYVNSQAYLQTVS
TPSGGLSSGGLAEPKYNVDMTAFTGAWGRPQRDGPALRATALIDFGNWLIDNGYSSYAVN
NIWPIVRNDLSYVSQYWSQSGFDLWEEVNSMSFFTVAVQHRALVEGSTFAKRVGASCSWC
DSQAPQILCYMQSFWTGSYINANTGGGRSGKDANTVLASIHTFDPEAGCDDTTFQPCSPR
ALANHKVYTDSFRSVYAINSGIPQGVAVSAGRYPEDVYYNGNPWFLTTLAAAEQLYDAIY
QWKKIGSISITSTSLAFFKDIYSSVAVGTYASSSSTFTAIIDAVKTYADGYVSIVEAHAM
TNGSLSEQFDKSSGMSLSARDLTWSYAALLTANMRRNGVVPAPWGAASANSVPSSCSMGS
ATGTYSTATATSWPSTLTSGSPSDTTSGTTPGTTTTTSACTTPTSVAVTFDEIATTTYGE
NVYIIGSISQLGSWDTSKAVPLSSSKYTSSNNLWYVTINLPAGTTFEYKYIRKESDGSIE
WESDPNRSYTVPSACGVSTATEKDTWR
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcctttcctacgcgctctgtgcgctgtctctcgggcatgctgctattgcagct
cctcagttatcccctcgtgctactggcagcttggactcctggttggctactgagtctact
gtttcgctgaatggtattctggccaacatcggtgccgacggtgcttatgcgaagagcgct
aagcctggcataattattgccagtccgagcaccagcgacccagactactactatacttgg
acgagagatgctgctctcgtcacgaaagtcctggtcgatctcttccgcaacggcaacctg
ggtctgcagaaagttattacagaatatgtcaactctcaggcctacttgcagaccgtttct
actccgtctggtggtctttcgagcggaggtctcgcggagcctaagtacaacgtcgacatg
actgcctttaccggagcctggggtcgtcctcagcgcgatggtccggctctgcgtgccacc
gccctcatcgactttggcaactggctgattgacaacggttactccagctatgccgtcaac
aacatctggcccattgtgcgcaacgacctgtcctacgtttctcagtactggagccagagt
ggttttgatctctgggaagaagtgaactccatgtccttcttcaccgtcgctgtccagcac
cgtgccctcgttgagggaagcacatttgctaaacgggtgggagcttcgtgctcgtggtgt
gactcgcaggcccctcagatcctctgctacatgcagagtttctggactggctcgtatatc
aacgccaacaccggtggtggccggtccggcaaggatgccaacaccgtcctcgccagcatt
cataccttcgaccccgaagccggctgcgacgatactactttccaaccctgctctcctcgg
gcccttgccaaccacaaggtgtacaccgattcgttccgctcggtctacgcgatcaactcc
ggcatcccacagggcgttgccgtttccgctggccgctatcccgaggatgtctactacaac
ggcaacccctggttcctcaccaccctcgccgctgccgagcagctctacgacgctatctac
cagtggaagaagatcggttccatcagcattaccagcacctccctcgccttcttcaaggac
atctacagctccgtcgcggtcggcacctacgcctccagcagctccaccttcacggccatc
atcgacgccgtcaagacctacgcagacggctacgtgagcatcgtcgaggcccacgccatg
accaacggctccctttcggagcaattcgacaagtcctccgggatgtccctctccgcccgc
gacctgacctggtcctacgccgccctcctaaccgccaacatgcgtcgtaacggcgtggtg
cctgccccctggggcgccgcctccgccaactccgtcccctcgtcctgctccatgggctcc
gccacgggcacctacagcaccgcgacggccacctcctggcccagcacgctgaccagcggc
tcgccaagcgacaccacctccggcaccacccccggtaccaccaccacgacgagcgcctgc
acgacccctacctccgtggccgtcactttcgacgagatcgccaccaccacctacggcgag
aatgtttacattatcggatccatctcccagctcgggagctgggataccagcaaagccgta
cccctgagttcgtccaagtatacctccagcaataacctctggtacgtgaccatcaaccta
ccagctggcacgacattcgagtacaagtatatccgcaaggaaagcgacggctcgatcgag
tgggagagtgaccccaaccgctcgtatacggtgccgtcagcttgcggtgtgtcgacagcg
actgagaaggatacttggcggtga

DBGET integrated database retrieval system