KEGG   Aspergillus fischeri: NFIA_037130Help
Entry
NFIA_037130       CDS       T01070                                 

Definition
(RefSeq) SET and WW domain protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    NFIA_037130
Enzymes [BR:nfi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     NFIA_037130
Chromosome and associated proteins [BR:nfi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     NFIA_037130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET Med26 WW
Motif
Other DBs
NCBI-GeneID: 4592634
NCBI-ProteinID: XP_001266036
UniProt: A1CZG9
LinkDB All DBs
AA seq 967 aa AA seqDB search
MSSHDNADSPSSSVANAVTAMKIEQHDGAADMLLSNGGDAVLKHDPNGLSEHAVTAKDYP
EMDDLASSAIKSRTSSLTPIKSENGDSTAKEEKVGGDIIVKMEPGQPPKLSRSSSQKVVA
QPPQLFLHLPDSTAEAQSTFEVMETCTYANKYMGYTEHAMECDCAEEWEPSLSRNLACGE
DSDCINRATKIECVGDCSCGAECQNQRFQRKEYANVAVIKTEKKGFGLRAETDLRPHQFI
FEYVGEVINEAQFRRRMRQYDEEGIKHFYFMSLSRGEFVDATKKGNLGRFCNHSCNPNCY
VDKWVVGEKLRMGIFAERTIQAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGKTQTD
RATKLSNATIEALGIEDADSWDTAVAKRPRKKKMGEDDEEYVDSVQPKSLDENGVTKVMA
ALMQCKEKWIAVKLLRRIERCDDDRVRHRVVKMHGYQILNSQLSLWKDDFNVVLQILNIL
DGFPRLTRNKIIDSKIESTVQPLTTCGDERVEKKAAALLQHWATLEVGYRIPRMKRDPNA
VASVSQFGRREHTNDEQKRSQSRSRSRSRSLDAPRGPANPGRKSNGPRNSQHHGVRQFRR
QFNPLPPGWFAAESHGRTYYYCARGDVTWTRPIHAAPEAEVPGHQAKNKALQGIIDNILN
AKENTPREKTVTPGTPQASRETASLSEGQEKWRSYSEEKQKKLYENTLFPHIKYVVDKFK
HKLPKEDLKRYAKDVAKKLVNSDFKNNRVEDPTKISEKQQKKVKAFCKEFFDKAVAKHRA
YEQRKAEKQAKGGDSKADEMTNGHNTVEDVDVKLSDGEAEKVEENDTFMDSDPQGILKRK
REDEMDIGEGAAEEAMKRQKSSTPIPPPPPPPPPLGDEEQPTPNGTGEDYFQAENGVSML
HSPESAPTPPPPPPLSTEHSDNDESGRSPGMSNHLLEQKLFPAPLGEEYEADSGKLPSNR
IGIEGQV
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcatgacaacgcggactcaccctcatcttctgtagcaaatgcggtgaccgcg
atgaagattgagcagcatgacggcgccgcagacatgctcctctccaacggcggagacgcc
gttttgaaacatgatcccaacgggttatcagagcacgctgtcaccgccaaagattaccct
gagatggatgatctggcatcatccgctatcaaatcgcggacttcatctctaactccaatc
aaatccgaaaatggagattccacagccaaggaagagaaagtcgggggcgatatcattgtc
aagatggaacccggtcagcctcccaagttatcgcgcagctcttcgcagaaggttgttgcg
caaccccctcagctgtttctgcatttgccggacagcacggcggaggcacaatcgactttt
gaagtgatggaaacttgtacctatgccaataaatacatgggttatactgagcatgccatg
gaatgcgattgtgctgaggaatgggagccgtcgttgtccaggaatctggcatgtggagaa
gattctgattgtatcaatcgcgctaccaaaattgagtgcgtgggtgactgcagctgcggt
gccgaatgccagaatcaacgattccagcgcaaagagtatgcaaatgtcgcggttatcaag
acggaaaagaaagggttcggcctccgtgccgagactgatttgcgaccgcaccaattcatc
ttcgaatatgtcggcgaagtcatcaacgaggctcaattccggcgacgcatgagacagtat
gatgaagaagggatcaaacacttctatttcatgtcccttagtagaggagaatttgtcgat
gcgacgaagaagggcaacctgggtcgtttctgcaaccactcgtgtaatcccaactgctac
gtcgataaatgggttgtgggtgagaaattgcgtatgggaatctttgccgaaagaactatt
caagccggcgaagaactcgtcttcaattataatgtcgatcgttatggcgcggatcctcaa
ccatgctactgtggcgaaccgaattgcactggctttattggaggaaagactcagaccgat
cgtgctaccaagctttctaatgccaccattgaagctttgggtatcgaagatgctgatagc
tgggacactgctgttgcgaagcggccgcgaaagaagaagatgggcgaggatgatgaggag
tatgttgacagcgtacagcctaagtctctagatgagaacggcgtcaccaaggtcatggcg
gccctcatgcaatgcaaagaaaaatggattgctgtcaagttgctgaggcggatcgagcgc
tgcgacgatgaccgagtccgccatcgtgtggtgaagatgcatggctaccagattttgaat
tcccaactcagcttatggaaggatgacttcaatgttgtgttgcagatcctcaatattctg
gacgggtttccacgtcttacacggaacaagattattgattcaaagatcgaatccaccgtc
cagccgctgacaacttgtggagatgagcgagtcgagaagaaggcagccgcacttttgcag
cactgggcgactctggaggtcggataccgtatccctcgcatgaagcgagatccgaatgca
gttgcttcagtcagccagttcgggcggagagagcacactaatgatgagcagaaacgctct
caatctcgttcacgatcaagatcccggtcgttggatgctcctcgagggccagcgaatcca
ggtcggaagagcaatggccccagaaattcccagcatcacggtgtccgtcagttccgccgc
caattcaatcctctgcctccgggatggttcgcagccgaatcacacggccggacttattat
tactgcgcccgtggggatgtcacctggactcggccgattcatgccgcacctgaggccgaa
gtcccaggccaccaggcgaagaacaaagccctacaaggtattatcgataacatcttgaat
gctaaggagaacacgcccagggagaagaccgtcacacctggcacgccgcaagcttctaga
gaaacggcgagtctcagtgaagggcaggagaagtggagaagttacagtgaagagaaacag
aagaagctgtatgagaacacgcttttccctcatatcaaatatgtggtggacaaattcaaa
cacaagcttccgaaagaggatttgaagcgctatgctaaggatgttgccaagaagctcgtc
aactccgacttcaaaaacaatcgcgtggaagatccaacgaagattagcgaaaagcaacaa
aagaaagtcaaggccttctgcaaggaattctttgacaaggctgttgcgaagcaccgtgct
tacgagcagaggaaggccgagaagcaggcaaagggaggcgactcgaaagcagacgaaatg
accaatggacacaacaccgttgaagatgtcgacgtgaaactgtctgatggcgaagcagaa
aaggttgaagagaatgataccttcatggacagcgatccgcaaggcattctcaagcgcaag
agggaagacgaaatggatattggtgaaggggctgctgaagaagcgatgaagaggcagaag
tcatcaacacccatacctcctcccccaccgccaccgcctcctctaggtgatgaagagcaa
cccacgccaaatggcactggcgaagattacttccaggctgagaatggtgtttcaatgctg
catagcccggagtctgcgccaactcctcctcccccgccacccttgtcaacggagcacagt
gataacgatgaatcgggccgatcccccggtatgagcaatcatctgttagaacagaaactt
ttccctgcgcctttgggagaggagtacgaagccgactcgggaaagcttccgtcaaatcga
attggtatcgagggccaagtataa

DBGET integrated database retrieval system