KEGG   Aspergillus fischeri: NFIA_039600Help
Entry
NFIA_039600       CDS       T01070                                 

Definition
(RefSeq) glycogen synthase Gsy1, putative
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Module
nfi_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_039600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nfi01003]
    NFIA_039600
Enzymes [BR:nfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NFIA_039600
Glycosyltransferases [BR:nfi01003]
 Polysaccharide
  Storage polysaccharide
   NFIA_039600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_4 Glycos_transf_1
Motif
Other DBs
NCBI-GeneID: 4592641
NCBI-ProteinID: XP_001266281
UniProt: A1D064
LinkDB All DBs
AA seq 713 aa AA seqDB search
MDGEDTGPDPPKRDVRNHTLFEIATEVANRVGGIYSVLKSKAPVTTAEYGDRYTLIGPLN
RASAAVEVEELTPSNPRMVETMNSMKERGIDMVYGRWLIEGAPRVLLIDTGTGYKYLDEW
KGDLWNIAGIPSPASDTETNEAIVFGYLVAWFLGEFIAHERRRAVVAHFHEWLAGVALPL
TKKRHMDLTTIFTTHATLLGRYLCAGSVDFYNNLQHFDVDAEAGKRGIYHRYCIERAAAH
SADVFTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFAAVHEFQNLHSQSKEKINDFVRG
HFYGHNDFDLDNTLYVFTAGRYEFRNKGVDMFIEGLARLNHRLKASGSKTTVVAFIIMPA
QTSSLTVEALKGQAVVKSLRDTIEMIEKSIGKRMYERCLAWKEGDNMPDEKDLITSQDRV
LLRRRLFAMKRHGLPPIVTHNMFNDHEDPILNQIRRVELFNYPTDRVKVIFHPEFLNSSN
PVLPLDYDDFVRGTHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSS
DYGIYIVDRRMKGVDDSVNQLTEFMFNFTQKSRRQRINQRNRTERLSDLLDWKRMGLEYV
KARQLALRRAYPSSFDGAEDYFDVIGGTEQKLSRPLSVPGSPRDRSGVMTPGDFATIQEV
KEGLDTEDYIAWRLPTSEEEEPDDHYFPLTLRTKKSSDRPSSPLDSIPVNGGR
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgaggatactggtcccgaccctcccaagagagatgtgcgcaaccacaccctc
ttcgagattgctaccgaagtcgccaaccgagtcggtggtatttactcggtgctgaaatct
aaagctccggtcactacagctgaatatggcgatcggtacaccctgatcgggcctctgaac
cgggcgtccgcagccgtggaggtggaggagctgactccctcgaacccccgcatggtggag
actatgaactccatgaaggagcgtggcattgacatggtgtatggtcgctggctgattgag
ggtgctccccgggttctcctcatcgatacaggaactggatacaagtacctggatgagtgg
aagggcgacctgtggaatatcgccggtattccgtctccggcgtcggatacggagaccaat
gaggctattgtcttcggttacctggtagcatggtttttgggagaatttatcgctcacgaa
cgccggcgtgcagtagtcgctcatttccacgaatggcttgccggtgtcgccctacctctg
accaagaagaggcacatggatttaaccactatcttcacgactcatgcaactttgcttggt
cggtatctttgcgccggatctgtcgacttttacaacaatctacagcatttcgatgtggac
gccgaggctggcaagagaggcatctatcataggtactgcattgagagagccgccgcacac
agcgcagacgtcttcactacggtctcacacatcactgcatttgaaagtgagcatctgctc
aagcgcaaaccggacggggtgcttcccaatggattgaatgtcaagaaattcgcagcggtg
catgagttccaaaacttgcactcccagtccaaagagaagatcaacgacttcgttcgcggt
cacttctatggccacaatgactttgatctggacaacacactctacgtcttcacggcaggt
cggtatgaattccggaacaagggagtggatatgttcatcgagggcctggctcgtcttaat
catcgcctcaaagctagcgggtccaagacgaccgttgtggcctttatcatcatgcctgcc
cagacctcgtcgctgactgtggaggctctcaagggtcaagctgtcgtcaagtccttgcga
gacacaatcgagatgatcgaaaagagtattggaaaacggatgtacgagcgttgcctagcc
tggaaagaaggcgacaacatgcccgacgagaaggatttgattacaagccaagaccgtgtg
ctgctgcgtcggagacttttcgccatgaagcggcacggattgcctccgattgtgacgcac
aacatgttcaatgaccatgaggatccgattctcaaccaaatccgtcgggttgaacttttc
aactacccgacggaccgcgtcaaggtcatcttccatccggagttcctgaactcctccaac
cctgttctgcctctggattacgacgactttgtccgtggtacgcatctgggagtcttccca
tcgtactacgaaccctggggttacacgcctgcggaatgtaccgtgatgggcgttccaagc
atcaccaccaacttgtccggtttcggctgctacatggaagaattgattgaaaactcctcc
gactatggaatttacattgtggaccgtcgcatgaaaggcgttgatgactctgtcaatcag
ctgactgaattcatgttcaattttacccagaagagccggcgacagcgcattaaccagagg
aaccgcacggaacgtttgagtgatctgctggattggaagcgtatgggtttggaatatgtc
aaggctagacagctggctctaaggagagcctacccttcatccttcgatggtgccgaagac
tatttcgacgtcattggaggaacagagcagaagctttcgcgtccattgtcagtccccggg
tctccgcgggatcgatctggagtgatgactccgggtgattttgctaccattcaggaagtc
aaggagggtctggacactgaggactatatcgcatggcgtctacctactagcgaagaggaa
gagccggatgaccattacttcccactcactctacggacgaagaagtcttcggaccggcct
tcgtcgccgctggatagcatccccgttaacggtggccgctga

DBGET integrated database retrieval system