KEGG   Aspergillus fischeri: NFIA_045530
Entry
NFIA_045530       CDS       T01070                                 

Definition
(RefSeq) phytanoyl-CoA dioxygenase, putative
  KO
K17825  verruculogen synthase [EC:1.14.11.38]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00404  Staurosporine biosynthesis
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00786  Fumitremorgin alkaloid biosynthesis, tryptophan + proline => fumitremorgin C/A
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    NFIA_045530
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.38  verruculogen synthase
     NFIA_045530
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-GeneID: 4594309
NCBI-ProteinID: XP_001267631
UniProt: A1CVF7
LinkDB
AA seq 297 aa
MTVPDNSSKPQIQRVPADADPNAIRQLLEEDGAAIIEGVFSEDIIQSFNQDLNPAATAAE
MAAKTNYEFQFPQQSKYVFNLPGKSATFRNDILNSPVLHGLAKSVFAETGDYWLTASFLR
ELHAGHNPQELHRDESTHPLLRSLKLGAPPLAISFILALTDFTKDNGGTRVILGSHKWPE
IGNPRPDQTVSTEMKAGDVLVLAQGMVHGGGAHPEDLPEARRAVLVFFSSCQLTPFETFM
TMPREIVETMTPLAQQMIGWRSAKPGPPNVSGLHTSDSKLLEDALQLRANQSQGKGL
NT seq 894 nt   +upstreamnt  +downstreamnt
atgactgttcctgacaattcctcaaaacctcaaatccaacgggtcccagccgatgcagac
ccaaacgccatccgccaactcctcgaagaggacggggcggcgattatcgaaggcgtcttc
tcagaagacataatccaaagcttcaaccaggaccttaacccggctgcgacagctgcagaa
atggcagccaagaccaactacgagttccagttcccacaacagtcaaaatatgtattcaac
ttgcctggaaaaagcgctaccttccgaaatgatatcctgaacagccctgttctccacggc
cttgccaagagtgtcttcgcagagaccggggattactggttgacagcgtcattcctgaga
gagcttcacgcaggccataatccccaagagctgcaccgtgacgagtcaactcaccctctg
cttcgcagcctgaagctgggcgcaccacccctcgctatcagttttatccttgctctgaca
gactttacaaaagataatggcgggacccgtgtcatcctgggaagtcacaaatggccagag
atcgggaaccccaggcctgaccagacagtgtcaactgagatgaaggccggggatgtactt
gttttggcccaggggatggtgcatggcgggggtgcgcaccctgaggatctgcctgaggcg
cgacgagctgttttggtcttctttagtagctgtcagcttactccctttgagacctttatg
acaatgcctcgtgaaatcgttgaaaccatgacccctcttgcccaacaaatgattggctgg
aggtctgcaaagcctggtcctccgaacgtgtctggcctccacacttccgattcgaagctg
ctggaagatgccctccagttaagggccaaccaatcacagggaaaaggactgtga

DBGET integrated database retrieval system