KEGG   Aspergillus fischeri: NFIA_050510Help
Entry
NFIA_050510       CDS       T01070                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00010  Glycolysis / Gluconeogenesis
nfi00051  Fructose and mannose metabolism
nfi00052  Galactose metabolism
nfi00500  Starch and sucrose metabolism
nfi00520  Amino sugar and nucleotide sugar metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
nfi01200  Carbon metabolism
Module
nfi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nfi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_050510
   00051 Fructose and mannose metabolism
    NFIA_050510
   00052 Galactose metabolism
    NFIA_050510
   00500 Starch and sucrose metabolism
    NFIA_050510
   00520 Amino sugar and nucleotide sugar metabolism
    NFIA_050510
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NFIA_050510
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     NFIA_050510
Membrane trafficking [BR:nfi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    NFIA_050510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 4584118
NCBI-ProteinID: XP_001257603
UniProt: A1DLN5
LinkDB All DBs
AA seq 420 aa AA seqDB search
MPQPMNVTWVMGYPTGKEQGKFLILDMGGTNLRVSQAELFGSDRDMESIQEKYSIPQSIK
QGTADDLWDFVADCVRKFLQSRLSESERSKVLPLAFTFSYPVIQSSIKVGVLQRWTKDFC
VSGVEGHDVVFQLEAAFERKQIPVRVVALINDTVGTLFAAAYGDREVKIGSIASTGCNAA
YMEEIGAIPKIQGCGLPSDALVAINTEYGAFDNSRRILPRTRFDDEIDRTSAHPGQQLYE
KMVSGPYLGELLRLVMLELHEAKLLFVGQDVSCLRQPNALDASLFPTLEEDIGECMENAR
KCLWEKMGLDPAPHELKACRYLAELVGTRAARLYSCGIAAICKKRNIERCHVGVDGSIFG
HYQNYRKRAAQALRDIFAWPDDLGDPIVFEFYEDGSGVGAALIAALALERSDGTVLSRTE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccacagccaatgaacgtaacttgggtcatgggctatccaacgggcaaggagcaagga
aagtttttgatcctcgacatgggaggcaccaacctgcgcgtaagtcaggcggagcttttc
ggtagtgatcgcgatatggagtccatccaggaaaagtacagtataccccagtcgatcaag
caaggtacagccgacgatctgtgggatttcgtggcggactgtgtgcggaagtttctccag
tcacgactcagtgaaagtgaaagatcgaaagtgttgccgcttgcctttacgttctcctat
cccgtcattcagtcgtctataaaagtcggggtccttcagcgctggacgaaagatttctgc
gtatctggagttgaaggtcatgatgttgtatttcagttagaggctgcttttgaacggaag
caaattcccgtccgagtcgtggctttgatcaatgatacggtcgggacgctcttcgccgcg
gcgtatggagaccgagaggtcaagatcggtagtatagcaagcaccggttgcaacgctgca
tacatggaagagattggtgcaatcccaaagatccaaggctgcgggctaccaagcgatgct
ctcgtcgcgatcaacaccgagtacggtgcctttgataattcacgccgcatactgccgcgg
acacgattcgatgatgaaatcgaccggacatccgcgcatccaggccagcagctttacgag
aagatggtctccgggccgtacctgggggagctgctccgactggtgatgttggaactgcac
gaagccaaacttctctttgtaggtcaggatgtttcgtgcttgcgccagccaaatgccctg
gacgcttccctcttcccaaccctggaggaggatatcggcgagtgcatggaaaacgctcgt
aagtgtctgtgggagaagatgggccttgatccagctccgcacgaactcaaggcctgtcga
tacctggccgagttggttgggacgcgtgctgcccgtctctattcatgtgggatcgcagcg
atctgcaagaaacgcaatatcgaacgctgccatgtgggcgttgatgggtcaatttttggt
cattatcagaattaccgcaagcgagcggcgcaggccctccgtgatatttttgcatggccc
gatgaccttggggatccgattgtatttgagttctacgaagacgggtctggagttggcgcc
gcgttgatcgctgcgttggctcttgagagatcggatggaactgttcttagcaggacagag
tag

DBGET integrated database retrieval system