KEGG   Aspergillus fischeri: NFIA_053440Help
Entry
NFIA_053440       CDS       T01070                                 

Definition
(RefSeq) alanine aminotransferase, putative
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00220  Arginine biosynthesis
nfi00250  Alanine, aspartate and glutamate metabolism
nfi01100  Metabolic pathways
nfi01200  Carbon metabolism
nfi01210  2-Oxocarboxylic acid metabolism
nfi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NFIA_053440
   00220 Arginine biosynthesis
    NFIA_053440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nfi01007]
    NFIA_053440
Enzymes [BR:nfi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NFIA_053440
Amino acid related enzymes [BR:nfi01007]
 Aminotransferase (transaminase)
  Class I
   NFIA_053440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 4584410
NCBI-ProteinID: XP_001257895
UniProt: A1DMH7
LinkDB All DBs
AA seq 495 aa AA seqDB search
MTVPYTTKRTASDLGPRRLRADNINPNVKAAKYAVRGELAVKAEEYRVRLAKGDKSLPFD
SVIFANIGNPQQLDQKPITFFRQVLSLLENTALLEKPEVLRSSFGYNQDVIDRAKKLLAD
IQSVGAYSHSQGAPLIRESVARFIEERDGFPANPQDLYLCAGASSGVSTLLNVICNAPTA
GVLVPIPQYPLYTATLSLLNAQCVPYHLEEDKAWGTDVEAIRQSLVRAKAEGTEVRAIVV
INPGNPTGASLSPEDIKSVLDIAAEEKLVVIADEVYQTNVFVGEFTSFKKRLRQLQQEVP
GKYDNVELASLHSVSKGMVGECGHRGGYFELVGFDPLVAAEIYKFVSIMLCPPVIGQCLV
ELMVNPPKKGEPSYELYQKEYNGISDGLHKRALALYEAFKQMEGVECQEPQGAMYLFPSI
TLPPKAVEAAAAEGRNADEFYCLRLLDATGVCVVPGSGFGQKENTLHFRTTFLAPGTDWV
ERIVKFHAEFMAKYK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgccatataccaccaagcggaccgcttctgatctcggccctcgtcgtctccgt
gccgataatatcaatcccaacgtcaaggcagccaagtatgctgtccgtggtgagcttgcc
gtcaaggcggaggagtaccgcgtgagattggccaagggagacaagtctttgcccttcgac
agtgtcattttcgccaatattggcaacccccagcagctggatcagaaacccatcactttc
ttccgtcaagtactcagtcttctcgagaacaccgcgttgctggaaaaaccggaggtcctg
cggtcgtctttcggctacaaccaggacgtcattgaccgggctaagaagcttctggcagac
attcagagcgtcggtgcctacagtcacagccagggagcaccattaatccgggagagcgtg
gccagattcatcgaggaacgtgatggcttccccgccaacccgcaagatctgtacctctgc
gctggtgcgtcgtccggtgttagcacgctgctgaacgtcatctgcaacgctcccaccgcc
ggtgtccttgtgccgattccccaatatcctctgtacaccgccaccctgtcccttctcaat
gcgcagtgcgtcccataccatctggaggaggacaaggcctggggtaccgacgtggaggcc
atccggcaatctctggtgcgcgccaaggccgagggcaccgaggttcgtgccatcgttgtc
atcaaccccggtaacccgacgggtgcctcgctgagccccgaggacatcaagagcgtgctt
gacatcgccgccgaggagaagctggtcgtcatcgccgacgaggtgtaccaaaccaacgtc
ttcgtgggcgagttcacatcgttcaagaagagactgcgccaactgcagcaggaggtgcct
ggcaagtacgacaacgtcgaactcgcttctctgcacagtgtgtccaagggtatggtgggc
gaatgcggtcaccgaggcggttacttcgagctcgtcggattcgaccccttggtcgcggcc
gagatctacaagtttgttagcattatgctgtgcccgccggtgatcggccagtgtctggtc
gagcttatggtgaacccacccaagaagggcgagcccagttacgagttgtatcagaaggag
tacaacggcattagcgatggcctacacaagcgtgctctcgccctgtacgaagccttcaag
cagatggagggcgtcgaatgccaggagcctcagggcgccatgtacctcttccccagcatc
accctgccccccaaggccgtcgaagccgccgctgccgaaggccggaacgccgacgaattc
tactgcctgcgcctcctcgacgccacgggtgtttgcgtggtccccggttccggctttgga
cagaaggagaacacgctccacttccgcacaaccttccttgcccccggcactgactgggtc
gagcggatcgtcaagttccacgccgagttcatggccaagtataaatag

DBGET integrated database retrieval system